KEGG   Bacillus subtilis BEST7613: BEST7613_1064Help
Entry
BEST7613_1064     CDS       T02410                                 

Gene name
asnO
Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bsub  Bacillus subtilis BEST7613
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsub00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BEST7613_1064 (asnO)
Enzymes [BR:bsub01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     BEST7613_1064 (asnO)
Peptidases [BR:bsub01002]
 Cysteine Peptidases
  Family C44
   BEST7613_1064 (asnO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1132469..1134313
Genome map
AA seq 614 aa AA seqDB search
MCGITGWVDFKKQLVQEKQTMDRMTDTLSKRGPDDSNVWGEHHVLFGHKRLAVVDIEGGR
QPMACTYKGDTYTIIYNGELYNTEDLRKELRARGHQFERTSDTEVLLHSYIEWQEDCVDH
LNGIFAFAVWDEKRNLLFAARDRLGVKPFFYTKEGSSFLFGSEIKAILAHPDIKARVDRT
GLSEIFGLGPSRTPGTGIFKGIKEIRPAHALTFSKDGLNIWRYWNVESEKHTDSFDDTVA
NVRSLFQDAVTRQLVSDVPVCTFLSGGLDSSAITAIAAGHFEKEGKAPLHTYSIDYEEND
KYFQASAFQPNDDGPWIEKMTEAFGTTHHKCVISQKDLVDHLEEAVLVKDLPGMADVDSS
LLWFCREIKKDFVVSLSGECADEIFGGYPWFHTADVESGFPWMRSTEERIKLLSDSWQKK
LNLKEYVNAKYEETLAETPLLDGETGVDKARRQLFYLNMLWFMTNLLDRKDRMSMGASLE
VRVPFADHRLVEYVWNIPWEMKMHDNREKGILRKALEGILPDDILYRKKSPYPKTHHPEY
TKGVSEWLKTIRSQKDSVLHTLLDRKQLDQLLETEGSSFKVPWFGQLMKGPQLIAHLAQI
HTWFEAYRIDIDER
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaattacgggttgggtcgattttaaaaagcagctcgtccaggaaaaacaaacg
atggacagaatgacagacactctttccaaacgagggcctgatgattcaaacgtttggggg
gagcaccatgttttattcggacataaaagacttgcggttgttgatattgaaggcggacgc
cagccgatggcgtgtacctataaaggcgatacgtacaccattatttacaatggcgagctt
tataacacggaagatttgcgcaaagaattgcgggcgcggggccatcaattcgagcgtacg
tcagataccgaggtgcttctgcacagctacatcgagtggcaggaagactgtgtcgaccat
ctcaatggcatattcgctttcgctgtgtgggatgaaaagcgtaatctgttgtttgccgcg
agagaccgtctcggtgtaaagccgtttttttacacgaaggaaggctcttcatttctcttc
gggtcggaaatcaaagcaatcctcgcgcaccctgatataaaagcgcgagtggacagaacg
ggactttctgaaattttcggtcttggaccgtccagaaccccgggcactggcatatttaaa
ggcataaaagaaatccgcccggctcacgcgctgacattttccaaagacggacttaatatt
tggcgttattggaatgttgaaagcgaaaaacatacggacagttttgatgacacggttgcc
aatgtcagatcgttatttcaggacgcggtgacgcggcagcttgtgtcggatgtgcctgtt
tgcacattcctatcaggcggtctggactcaagcgcgattacagcgattgcggcgggccat
tttgaaaaggaaggaaaagcaccgcttcatacttattcgattgattacgaagagaacgat
aaatattttcaagcaagcgcttttcagccgaatgatgacggaccatggattgaaaaaatg
acagaggctttcggcacaacgcaccacaaatgcgtcatcagccaaaaagacctcgttgat
catttggaggaagctgtactggtcaaagacttgccgggaatggcagatgtcgactcatcc
ctgctgtggttttgccgggaaatcaaaaaggactttgtcgtcagcctatcgggagaatgc
gcggatgagattttcggcgggtacccgtggttccatacggcagatgttgagtctggcttt
ccatggatgagatcaacggaggagcggatcaagctgctttctgactcatggcagaaaaaa
ttgaatctgaaagaatacgtaaatgccaaatatgaagaaaccttggcagaaacgccatta
ttagacggagaaacgggtgtggataaagcaagaagacagctgttctatttaaatatgctt
tggtttatgacgaaccttttggatcggaaggatcgcatgagcatgggggcgagcctggaa
gtgcgggtgccgttcgccgatcaccggcttgtggaatatgtttggaatattccgtgggaa
atgaaaatgcatgataatcgggaaaaaggcattttgcgcaaagcgcttgagggcattttg
cctgatgacattttgtatcgcaaaaaaagcccatatccgaaaacacatcatccggaatat
acaaaaggcgtcagcgagtggctgaaaacgatcagaagccaaaaggactccgtgctccat
accttactggacagaaaacaattagatcagcttttagaaacggaaggctcctccttcaag
gtcccgtggttcgggcagctcatgaaggggcctcagctgatcgcccatcttgctcaaatt
catacatggtttgaagcgtatcgcattgatattgacgagaggtag

  All links  
No link information was found.   
DBGET integrated database retrieval system