KEGG   Bacillus subtilis BEST7613: BEST7613_1220Help
Entry
BEST7613_1220     CDS       T02410                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bsub  Bacillus subtilis BEST7613
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:bsub00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BEST7613_1220 (hemD)
Enzymes [BR:bsub01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BEST7613_1220 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1269370..1270182
Genome map
AA seq 270 aa AA seqDB search
MGKGLLGKRVAIGGSRKTEEISTIIEKQGGIPVIRPLQGTVYLAEKQVEPDLRTFAEEKA
DWVIFTTGIGLETLVDMAEKIGLKDEFLQAIRQAKAACRGYKTLSALKKLGITPEASDED
GTTRGLIRSLEPHDFSGKTVMVQLHGEKAPALMAFLEEKGASVLPILPYQHIPPEEETVE
RLCRELMNDEVDAVCFTTAIQVRSLFDFAKGRGYINEVKKVFEERAIAAAVGKVTAEALR
EEGITRLLAPEIERMGAMIVELAKYYEEKE
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaagggttacttggaaaacgcgtggcaatcggtggctcacgaaaaacggaagaa
attagtacaatcattgaaaaacagggcggaatacctgtcatccggcctctccaaggtaca
gtttacttagcagagaagcaggtggagccggatttgcggacgtttgcggaagaaaaagct
gactgggtcattttcacgacaggcatcgggttggagactcttgtcgatatggcagagaaa
attggactgaaagatgagtttctgcaggccattcgccaagcgaaagcggcatgccgggga
tacaaaacgctgtctgcgctgaaaaagcttggaatcacaccggaagcttcggatgaagac
gggacaacaagaggcttaatccgttccttggagcctcacgacttttcaggaaaaacagtc
atggtgcagcttcatggcgaaaaagcgccggctctcatggcatttcttgaagaaaaaggc
gcgtctgtcctgccgattctgccttatcagcacatcccgccggaggaggaaacggtggag
cggttatgccgagagctgatgaacgatgaggtcgatgccgtttgttttacaacggccatt
caggttcgttccctgtttgattttgccaaggggcgaggttatatcaatgaagtgaagaag
gtattcgaagaacgcgccatcgcagctgctgtcggaaaagtgactgctgaagcactgcgg
gaagagggcattacgagactgcttgcgccagagattgagcggatgggtgcgatgattgtt
gagctggccaagtattatgaagaaaaggaataa

DBGET integrated database retrieval system