KEGG   Bacillus subtilis BEST7613: BEST7613_1954Help
Entry
BEST7613_1954     CDS       T02410                                 

Gene name
chlI
Definition
Mg chelatase subunit ChlI
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
bsub  Bacillus subtilis BEST7613
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsub00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BEST7613_1954 (chlI)
Enzymes [BR:bsub01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     BEST7613_1954 (chlI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2041527..2042600
Genome map
AA seq 357 aa AA seqDB search
MTATLAAPSKTRRVVFPFTAIVGQDEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRAL
ADLLPEIEVVANDPFNSSPSDPEMMSEEVRIRVDSQEPLSIVKKKVTMVDLPLGATEDRV
CGTIDIEKALSEGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDSAAGGWNTVERE
GISIRHPARFVLVGSGNPEEGELRPQLLDRFGMHAEIRTVREPELRVKIVEQRTEFDQNP
HPFCDQYQTEQEALQAKIVNAQNLLPQVTIDYDYRVKVSEVCAELDVDGLRGDIVTNRAA
KALAAFEGRTEVTVDDISRVIVLCLRHRLRKDPLESIDSGSKVEKVFKRVFGVVDEA
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgactgccacccttgccgcccccagcaaaacccgccgtgttgtttttccttttacggcg
atcgtcggtcaagatgaaatgaagttggccctgttgctcaatgtcattgatcccaagatt
ggcggcgtcatgatcatgggcgatcggggaaccgggaaatccactaccattagagctttg
gcggatttgttgccggaaattgaggtggtggccaatgatccttttaactcttcccccagc
gatcccgagatgatgagtgaggaagtacggatccgggtagatagccaagaacctttatct
attgtcaaaaagaaagtcaccatggtggatttgcccctgggggcaacggaagaccgggtg
tgcggcaccatcgacatcgaaaaggcattatcagaaggagttaaagcctttgaaccgggt
ttattggccaaagccaaccggggcattctctatgtggacgaagttaacctgttggacgat
cacttagtggacgtgttgttggactccgctgctgggggttggaacacggtggagcgggaa
ggtatttccattcgccatccggcccggtttgttttagtgggttccggtaacccagaagaa
ggggaattgcggcctcaattgttggatcgattcggcatgcatgctgaaattcgcactgtg
cgggaaccggaattgcgggtaaaaattgtcgaacaacggacggagtttgaccaaaatccc
catcctttctgtgaccaatatcaaacggaacaggaagcgttacaagcaaaaattgttaat
gcccagaatttactgccccaagtgaccattgactacgactatcgggtgaaagtatcggaa
gtctgtgcagaacttgatgtggacgggttacggggagatattgttaccaatcgggccgcc
aaagccctggccgcttttgaaggtcgcactgaggtaacagtggatgatattagccgagta
attgtgctttgtttacgccatcgtttacggaaagatcctctagagtccattgattccggc
agtaaggtggaaaaggtatttaaacgggtttttggcgttgtcgatgaagcttaa

DBGET integrated database retrieval system