KEGG   Bacillus subtilis BEST7613: BEST7613_2714Help
Entry
BEST7613_2714     CDS       T02410                                 

Definition
hypothetical protein
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
bsub  Bacillus subtilis BEST7613
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:bsub00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2834584..2835783)
Genome map
AA seq 399 aa AA seqDB search
MITPLSWQALAELSDYQVDTVNGPTNAQATLRLFGQSKESLQVTLYRDNHAWCPYCQKVW
LWLEEKQIPYRIKKVTMFCYGEKEDWYKKLVPSGMLPALELDGRFYTESDDILIALEKAF
GPLLWAMEDPLVLPLRKLERLLFRAWCNWLCYPAMFPGADQRNQQQFQQVVNQVEKALEK
LPGPYFLPEFSTADIVFVPYVERMNASLFYYKGYSLREDNPRLKDWFAALETRMTYRGTQ
SDFHTHAHDLPPQMGGCYSNGSVQAQQNQQRVDNGPWFGLPDATCPEPENVKQEAIARVV
KHHENIIKVNAHNQGEKFDQALRCALTLLATGEKCAAPQGTDQALRYLRDRINVPRDMSI
YAAKHLRQALETTASLVGDSEGEPIPVRHRRDQDPANFR
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgattactcccctttcttggcaagctttagctgaactatccgactatcaggtggatacg
gttaatggtcccaccaatgcccaggcaactctgagattatttggacaatcaaaggagtct
ttacaagttactctttatcgcgataaccatgcctggtgcccctattgtcaaaaagtttgg
ttatggttagaagaaaagcaaattccttaccgaatcaaaaaggtgaccatgttttgctat
ggggaaaaggaggattggtataaaaaattagtgccatcgggaatgttgcctgccttggaa
ctggatggtagattttacactgaaagcgatgatattttaatagccttagaaaaagctttt
ggaccattgctttgggcgatggaagatccattggtattaccccttagaaaactagaaagg
ttactgtttcgagcctggtgtaattggctctgctaccctgccatgtttcccggtgctgat
caacggaatcaacaacagtttcaacaggtggtgaatcaagtggaaaaagcattggaaaaa
ttacctggcccgtatttcttaccagaatttagcactgctgacatcgtttttgttccctac
gtggagcgcatgaatgcgagcttgttttattacaaaggttattccctaagggaggataat
ccccgcttaaaagactggtttgcggcgctggaaacccggatgacctataggggtacccag
agtgatttccatacccatgcccatgatttgccgccccaaatgggtggttgttactccaac
ggtagtgtccaggcccagcagaatcaacagcgggtggacaacggcccttggtttggttta
cccgatgccacctgcccggaaccggaaaatgttaagcaagaggcgatcgccagggtggtg
aaacaccacgaaaatattattaaggtcaatgcccataaccagggggaaaagtttgatcaa
gctctgcgctgtgcgttgaccctactggccacgggggaaaaatgtgcggcaccccagggt
acagaccaagcattgcgttatctgcgggatcggattaatgtgcccagggatatgtccatt
tatgcagctaaacatcttcgtcaagctttggaaaccaccgccagtttagtgggggacagc
gaaggagaacccattccagtgcgccaccgccgggatcaagacccagcaaattttcgctga

DBGET integrated database retrieval system