KEGG   Bacillus subtilis BEST7613: BEST7613_3069Help
Entry
BEST7613_3069     CDS       T02410                                 

Gene name
mtnD
Definition
acireductone dioxygenase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
bsub  Bacillus subtilis BEST7613
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:bsub00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BEST7613_3069 (mtnD)
Enzymes [BR:bsub01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     BEST7613_3069 (mtnD)
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     BEST7613_3069 (mtnD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3196780..3197316
Genome map
AA seq 178 aa AA seqDB search
MATIRIHDEANTTIENQEEVASFLDSQEVIYEQWDITRLPEHLSEKYDLTEEEKQQILDT
FETEIKDISTRRGYKAQDVISLSDSNPKLDELLENFKREHHHTDDEVRFIVSGHGIFVIQ
GQDGTFFDVRLNPGDLISVPENIRHYFTLQEDRKVVAVRIFVTTEGWVPIYEKDSVNQ
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atggctacaattcgaattcatgatgaggcaaatacaacgattgaaaatcaagaggaagtg
gcaagctttctggacagtcaagaggttatttatgagcaatgggatatcacgaggcttccg
gaacatctctcagagaaatatgacctgacagaagaagaaaaacagcaaattcttgatacc
ttcgaaactgaaattaaagatatctcaacccgccgcggctataaagcacaggatgttatt
tcattgtcagacagcaatccgaaacttgatgaactgcttgaaaactttaaaagagagcat
caccatacagacgatgaggttcgttttattgtaagcggacacggtatttttgtcattcaa
ggccaggacggcacgttttttgatgtccgtttaaaccctggagatttaatctccgtgcct
gagaatatccgccattacttcacgcttcaggaggaccgcaaagttgtcgcggtgagaatt
tttgtcacaactgaaggctgggttcctatttatgaaaaagacagcgtgaatcaataa

DBGET integrated database retrieval system