KEGG   Bacillus subtilis BEST7613: BEST7613_3198Help
Entry
BEST7613_3198     CDS       T02410                                 

Gene name
ylaM
Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
bsub  Bacillus subtilis BEST7613
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bsub00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bsub00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:bsub00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3318581..3319510
Genome map
AA seq 309 aa AA seqDB search
MVCQHNDELEALVKKAKKVTDKGEVASYIPALAKADKHDLSVAIYYSNNVCLSAGDVEKT
FTLQSISKVLSLALVLMEYGKDKVFSYVGQEPTGDPFNSIIKLETVNPSKPLNPMINAGA
LVVTSLIRGRTVKERLDYLLSFIRRLTNNQEITYCREVAESEYSTSMINRAMCYYMKQYG
IFEDDVEAVMDLYTKQCAIEMNSLDLAKIGSVFALNGRHPETGEQVISKDVARICKTFMV
TCGMYNASGEFAIKVGIPAKSGVSGGIMGISPYDFGIGIFGPALDEKGNSIAGVKLLEIM
SEMYRLSIF
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggtatgccagcataatgatgagcttgaagccttagtgaaaaaggcgaaaaaagtaacg
gacaagggggaggtagccagctatattcccgccttggcaaaagctgataaacacgacctg
tcagtggcgatttattattccaataatgtttgtctgtcagcaggtgacgtagaaaaaaca
tttacgcttcaaagtatatcgaaagtcctttcccttgctttggtgttaatggaatacggc
aaagataaggtcttcagttatgttggacaggagccgaccggtgatccgtttaattcaatt
atcaagctcgaaacagtgaatccgagcaagccgttaaaccctatgattaatgccggggca
ttggtagtgacaagtctgataaggggaagaacggtaaaagagagacttgattatttgctt
tcttttatcagaaggctgacaaacaaccaagagattacatactgccgggaagtggctgaa
tctgaatacagcacttcaatgattaatcgggcgatgtgttattatatgaagcagtacggc
atttttgaagatgatgtagaggcagtaatggatttatatacgaagcaatgcgcgattgag
atgaacagcttggatttagcgaaaatcggatctgtattcgcattgaacggcagacatcca
gagactggggagcaggtcatctcaaaagatgtcgctagaatttgcaaaacgtttatggtg
acgtgcggaatgtacaatgcaagcggggaattcgcaattaaggtcggaattcctgcgaaa
agcggcgtatccggcgggataatgggcatttcgccttacgatttcgggatcggcatattc
ggccccgcattagacgaaaaagggaacagcattgcaggtgtaaagcttttggaaataatg
tctgagatgtacaggctgagtattttttaa

DBGET integrated database retrieval system