KEGG   Bacillus subtilis BEST7613: BEST7613_3324Help
Entry
BEST7613_3324     CDS       T02410                                 

Gene name
sucC
Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bsub  Bacillus subtilis BEST7613
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bsub01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:bsub00020]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bsub00640]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism [PATH:bsub00660]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3447627..3448784
Genome map
AA seq 385 aa AA seqDB search
MNIHEYQGKEVLRKYGVSVPEGKVAFTAEEAVESAKSLSSSVYVVKAQIHAGGRGKAGGV
KIAKSLDEVKAYAEELLGKTLVTHQTGPDGQVIKRLLIEEGCDIKKEYYIGLVLDRATSR
IVLMASEEGGTEIEEVAEKTPEKIKKAVIDPAVGLQGYQAREIAFAINIPKELVGKAAKF
MLGLYKAFVEKDCSIAEINPLVVTGDGNVMALDAKLNFDSNALYRQKDIMEYRDLDEEDP
KEIEASKYDLSYISLDGNIGCMVNGAGLAMSTMDIIKHYGGEPANFLDVGGGATAEKVTE
AFKIILSDQNVKGIFVNIFGGIMKCDVIAEGVVEATRQVGLTLPLVVRLEGTNVDLGKKI
LSESGLNITSAESMADGAQKIVSLV
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatgagtaccagggaaaagaagtcctcagaaaatatggggtatctgttcct
gaaggtaaagtggcttttacagcagaagaagcagttgagagtgcaaagagcttatccagc
tcggtttatgtcgtaaaggctcaaattcatgctggcggtcgaggcaaagctggtggggta
aaaatagcaaaatcattagacgaagtaaaagcgtatgccgaagaactattagggaagacc
ctagttacacatcagacgggtccggacggccaagtaataaaacgcttacttattgaagaa
ggctgcgatattaaaaaagaatattacatcggtctagtgcttgaccgcgccacttcaaga
atcgttttaatggcttctgaagaaggcggaacggaaattgaagaggttgcggagaaaaca
ccagaaaaaatcaaaaaagctgtcattgatccagctgttggccttcaaggctatcaagcc
agagaaattgcattcgctattaatattccaaaagagctcgtgggaaaagctgctaaattt
atgcttggactatataaagcgtttgttgagaaagactgctcaatcgccgaaatcaatccg
cttgttgtgactggcgacggaaatgtgatggcgcttgatgcaaaattgaattttgacagc
aatgcgttgtaccgacaaaaggacattatggaatacagagatttggatgaagaagatccg
aaagaaattgaagcgtccaaatatgatctaagctacatttcccttgatggaaatatcggc
tgtatggtaaacggcgcgggacttgcaatgtctacgatggatattatcaagcattatgga
ggagaaccggccaacttccttgatgtgggcggcggtgcaaccgcggaaaaagtcacggaa
gcatttaaaatcattctttctgatcaaaacgttaaagggatttttgtcaacattttcggc
ggcattatgaaatgtgatgtcatcgcagaaggggttgttgaagcgactagacaagttggt
ttgacattgccgcttgtcgtccgtcttgaaggcacaaacgtggatctagggaagaaaatc
cttagtgaatcaggattaaacattacatctgcggaatcaatggctgacggcgcgcagaaa
atcgtatccttagtttaa

DBGET integrated database retrieval system