KEGG   Bacillus subtilis BEST7613: BEST7613_3358Help
Entry
BEST7613_3358     CDS       T02410                                 

Gene name
cheB
Definition
chemotaxis-specific methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bsub  Bacillus subtilis BEST7613
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:bsub02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:bsub02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3478932..3480005
Genome map
AA seq 357 aa AA seqDB search
MIRVLVVDDSAFMRKMISDFLTEEKQIEVIGTARNGEEALKKIELLKPDVITLDVEMPVM
NGTDTLRKIIEIYNLPVIMVSSQTEKGKECTINCLEIGAFDFITKPSGSISLDLYKIKEQ
LVERVVAAGLSGKRKRPVSQTVRPEPIVRAVVKPELSKPKPGTGRQIVCIGTSTGGPRAL
QKVIPKLPKDLNAPVVVVQHMPEGFTASLADRLNHLSDIQVKEAKDGEAALNGCVYIAPG
GKNISVIKNSEGLQVVLDNHDTPSRHKPSADYLFRSVGKLTDYEKVAVIMTGMGSDGTAG
LKDMLTAGNVKAIAESEESCVVYGMPKAAVKAGLIHEIKHVEDIAASITSCVKKERV
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
ttgattcgtgtgcttgtagttgatgattcagcttttatgagaaaaatgataagtgatttt
ctgaccgaagaaaagcagatagaagtaatcggaactgcgagaaacggagaagaagcgctt
aagaagattgaattattaaaaccggatgttattactcttgatgttgaaatgccggtcatg
aatgggacagatacgctccgcaaaattattgagatttataacttgccggtcattatggtg
tctagccagaccgagaaaggtaaagaatgcacaattaattgtttggagatcggtgccttt
gactttatcacaaagccatcaggctcaatatctctggatctatacaaaattaaagaacaa
ctagttgagcgtgtcgtcgcggcaggactttccggcaagcggaaacgtcctgtttcccag
acagttcggcccgaacctattgtgcgtgctgtcgttaagcctgaattaagcaaaccgaaa
cctggcacgggcagacaaattgtgtgtatcggcacatcaacaggcggtccacgggcgtta
caaaaggtgataccgaagctccctaaggatttgaacgcaccagtggttgtcgttcagcac
atgcctgaagggtttactgcttctttggctgatcggctgaatcatttatctgacattcag
gtaaaagaagcaaaagatggtgaagcagctcttaacggctgtgtttacatagcaccgggc
ggaaaaaacatatccgttattaaaaacagcgaaggactccaggttgtgcttgataaccat
gacacaccaagccgtcataaaccatctgctgattatttattccgttctgtcgggaaactg
acagattatgaaaaagtagcggttatcatgaccggaatgggcagtgacggcactgctgga
ctaaaggacatgctaacagccggcaatgtgaaagccattgcggagtctgaagaatcttgt
gtcgtatacgggatgccaaaagctgctgttaaagcgggtctcattcatgagattaaacat
gtggaagatatcgcagcatccatcacaagctgtgtgaaaaaagagagggtgtga

DBGET integrated database retrieval system