KEGG   Bacillus subtilis BEST7613: BEST7613_3371Help
Entry
BEST7613_3371     CDS       T02410                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bsub  Bacillus subtilis BEST7613
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bsub00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BEST7613_3371 (dxr)
Enzymes [BR:bsub01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     BEST7613_3371 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3490059..3491219
Genome map
AA seq 386 aa AA seqDB search
MATLKNICLLGATGSIGEQTLDVLRAHQDQFQLVSMSFGRNIDKAVPMIEVFQPKFVSVG
DLDTYHKLKQMSFSFECQIGLGEEGLIEAAVMEEVDIVVNALLGSVGLIPTLKAIEQKKT
IALANKETLVTAGHIVKEHAKKYDVPLLPVDSEHSAIFQALQGEQAKNIERLIITASGGS
FRDKTREELESVTVEDALKHPNWSMGAKITIDSATMMNKGLEVIEAHWLFDIPYEQIDVV
LHKESIIHSMVEFHDKSVIAQLGTPDMRVPIQYALTYPDRLPLPDAKRLELWEIGSLHFE
KADFDRFRCLQFAFESGKIGGTMPTVLNAANEVAVAAFLAGKIPFLAIEDCIEKALTRHQ
LLKKPSLADIQEVDKDTRGYVNSILT
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
gtggcaactttgaaaaatatttgtcttttaggagcaacaggatcaatcggcgaacagact
cttgatgtactgcgtgcacatcaagaccaatttcagctggtatctatgtcgtttggcaga
aatattgataaggccgttccaatgattgaggtctttcagccgaagtttgtctctgtcggt
gatctggatacatatcataaattaaaacaaatgtctttttcttttgaatgccaaatcggg
ctgggagaagaaggactgatagaagcagcagtgatggaggaggttgacattgttgtcaac
gctttgcttggaagcgtcggtcttatcccgacattaaaggcaattgaacagaaaaaaaca
attgcgcttgcaaataaggaaactcttgtcactgcagggcatatagtaaaagaacatgct
aagaaatatgatgttccgctgctgcctgttgacagtgagcattcagccatttttcaagct
cttcaaggcgaacaggctaaaaacattgaacgcctcatcattacggcatccggcggaagt
tttcgggacaagacgcgggaggagctcgaatcagtaacggttgaagatgcattaaaacat
ccaaactggtcaatgggtgcaaaaattacaattgattcggctacaatgatgaataaggga
ttagaggtgatcgaggcacactggcttttcgatataccttatgaacaaattgatgtggtt
ttacataaggagagcatcatccattcaatggttgagttccatgataaaagtgtgatcgca
cagctcggaactccggatatgagagtccccattcaatatgcgctcacttatcctgaccga
ttgccattaccagatgcgaaaaggcttgaattatgggaaatcggcagccttcattttgag
aaagctgattttgacaggttccgatgcttacaatttgcttttgaatcaggtaaaatagga
ggaacaatgccgacagtgctaaatgcggcaaacgaagtagctgtcgctgcctttttagct
ggcaagataccgtttttggctattgaagactgtatcgaaaaggcactaacccgccatcaa
ttactgaaaaaaccgagcctggcggacattcaagaagtggacaaagatacccggggatac
gtcaattcaatactcacataa

DBGET integrated database retrieval system