KEGG   Bacillus subtilis BEST7613: BEST7613_3536Help
Entry
BEST7613_3536     CDS       T02410                                 

Gene name
eglS
Definition
endo-1,4-beta-glucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bsub  Bacillus subtilis BEST7613
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bsub00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3707822..3709327
Genome map
AA seq 501 aa AA seqDB search
MKRSISIFITCLLIAVLTMGGLLPSPASAAGTKTPVAKNGQLSIKGTQLVNRDGKAVQLK
GISSHGLQWYGDFVNKDSLKWLRDDWGITVFRAAMYTADGGYIDNPTVKNKVKEAVEAAK
ELGIYVIIDWHILNDGNPNQNKEKAKEFFKEMSSLYGNTPNVIYEIANEPNGDVNWKRDI
KPYAEEVISVIRKNDPDNIIIVGTGTWSQDVNDAADDQLKDANVMYALHFYAGTHGQSLR
DKANYALSKGAPIFVTEWGTSDASGNGGVFLGQSREWLNYLDSKNISWVNWNLSDKQESS
SALKPGASKTGGWPLTDLTASGTFVRENIRGYKDSTKERPETPAQDNPTQEKGISVQYKA
GDGRVNSNQIRPQLHIKNNGDATVDLKDVTARYWYNVKNKGQNFDFDCDYAQIGCGNLTH
KFVTLHKPKQGADTYLELGFKNGTLAPGASTGNIQLRLHNDDWSNYAQSGDYSFFKSNTF
KTTKKITLYDQGKLIWGTEPN
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggtcaatttctatttttattacgtgtttattgattgcggtattgacaatgggc
ggcttgctgccttcgccggcatctgcagcagggacaaaaacgccagtagccaagaatggt
cagcttagcataaaaggtacacaactcgtaaaccgagacggcaaagcggtacaactgaaa
gggatcagttcacatggattgcaatggtatggcgatttcgtcaataaagacagcttaaaa
tggctgagagacgattggggcatcaccgttttccgcgcggcaatgtatacggcagatggc
ggttatattgacaacccgaccgtgaaaaataaagtaaaagaagcggttgaagcggcaaaa
gaacttgggatatatgtcatcattgactggcatatcttaaatgacggcaacccaaaccaa
aataaagagaaggcaaaagaatttttcaaggagatgtcaagtctttacggaaacacgcca
aacgtcatttatgaaattgcaaacgaaccaaacggtgacgtgaactggaagcgtgatatt
aaaccgtatgcggaagaagtgatttccgttatccgcaaaaatgatccagacaacatcatc
attgtcggaaccggtacatggagccaggatgtgaatgatgctgccgatgaccagctaaaa
gatgcaaacgtcatgtacgcgcttcatttttatgccggcacacacggccaatctttacgg
gataaagcaaactacgcactcagcaaaggagcgcctattttcgtgacggaatggggaaca
agcgatgcgtctggaaatggcggtgtattccttggccagtcgcgggaatggctgaattat
ctcgacagcaagaacatcagctgggtgaactggaatctttctgataagcaggaatcatcc
tcggctttaaagccgggagcatctaaaacaggcggctggccgcttacagatttaactgct
tcaggaacattcgttagagaaaacattcgcggctacaaagattcaacgaaagaacgccct
gaaacgccagcacaagataaccccacacaggaaaaaggtatttctgtacaatacaaagca
ggggatgggcgtgtgaacagcaatcaaatccgcccgcagcttcacataaaaaataacggc
gatgcgacggtggatttaaaagatgtcactgcccgttactggtataacgtgaaaaacaaa
ggccaaaactttgactttgactgtgactacgcgcagattggatgcggcaatctgacccac
aaatttgtgacgttgcataaaccaaagcaaggtgcagatacctatctggaacttggattt
aaaaacggaacgttggcaccgggagcaagcacagggaatattcagctccgtcttcacaat
gatgactggagcaattatgcacaaagcggcgattattcctttttcaaatcaaatacgttt
aaaacaacgaaaaaaatcacattatatgatcaaggaaaactgatttggggaacagaacca
aattag

DBGET integrated database retrieval system