KEGG   Bacillus subtilis BEST7613: BEST7613_3611Help
Entry
BEST7613_3611     CDS       T02410                                 

Gene name
xynA
Definition
endo-1,4-beta-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
bsub  Bacillus subtilis BEST7613
Brite
Enzymes [BR:bsub01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     BEST7613_3611 (xynA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Structure
PDB: 

Jmol
Position
complement(3806387..3807028)
Genome map
AA seq 213 aa AA seqDB search
MFKFKKNFLVGLSAALMSISLFSATASAASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSN
TGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTG
TYKGTVKSDGGTYDIYTTTRYNAPSIDGDRTTFTQYWSVRQSKRPTGSNATITFSNHVNA
WKSHGMNLGSNWAYQVMATEGYQSSGSSNVTVW
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgtttaagtttaaaaagaatttcttagttggattatcggcagctttaatgagtattagc
ttgttttcggcaaccgcctctgcagctagcacagactactggcaaaattggactgatggg
ggcggtatagtaaacgctgtcaatgggtctggcgggaattacagtgttaattggtctaat
accggaaattttgttgttggtaaaggttggactacaggttcgccatttaggacgataaac
tataatgccggagtttgggcgccgaatggcaatggatatttaactttatatggttggacg
agatcacctctcatagaatattatgtagtggattcatggggtacttatagacctactgga
acgtataaaggtactgtaaaaagtgatgggggtacatatgacatatatacaactacacgt
tataacgcaccttccattgatggcgatcgcactacttttacgcagtactggagtgttcgc
cagtcgaagagaccaaccggaagcaacgctacaatcactttcagcaatcatgtgaacgca
tggaagagccatggaatgaatctgggcagtaattgggcttaccaagtcatggcgacagaa
ggatatcaaagtagtggaagttctaacgtaacagtgtggtaa

DBGET integrated database retrieval system