KEGG   Bacillus subtilis BEST7613: BEST7613_3669Help
Entry
BEST7613_3669     CDS       T02410                                 

Gene name
odhB
Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bsub  Bacillus subtilis BEST7613
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bsub01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:bsub00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:bsub00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3859293..3860546)
Genome map
AA seq 417 aa AA seqDB search
MAEIKVPELAESISEGTIAQWLKQPGDYVEQGEYLLELETDKVNVELTAEESGVLQEVLK
DSGDTVQVGEIIGTISEGAGESSAPAPTEKTESKESVKEEKQAEPAAQEVSEEAQSEAKS
RTIASPSARKLAREKGIDLSQVPTGDPLGRVRKQDVEAYEKPASKPAPQQKQQPQAQKAQ
QSFDKPVEVQKMSRRRQTIAKRLVEVQQTSAMLTTFNEVDMTAVMNLRKRRKDQFFEQNE
VKLGFMSFFTKAVVAALKKYPLLNAEIQGDELIVKKFYDIGIAVAADEGLVVPVVRDADR
LTFAGIEKEIGELAKKARNNKLTLSELQGGSFTITNGGTFGSLMSTPILNSPQVGILGMH
KIQLRPVAIDEERFENRPMMYIALSYDHRIVDGKEAVGFLVTIKNLLEDPEQLLLEG
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaattaaggtacctgaattagcagaatcaatctcagaaggaacaatagcccaa
tggttaaagcagcctggtgactatgtagaacagggtgaatatctgcttgaactagaaacg
gataaagtgaatgttgaattgacagcagaagaatcgggtgtacttcaagaggtattgaaa
gattcgggtgataccgtccaggtcggagaaattatcggtacgatttcagaaggcgcgggt
gaaagttctgcccctgctcctacagagaaaacagaaagcaaggaaagcgtaaaagaagag
aaacaggctgaaccagctgcacaagaggtgagcgaggaagcacaatctgaagcaaaatca
agaacgatcgcttctccgtcggcccgtaagcttgcgagagaaaaaggaattgacctgtct
caagttccaactggagatccgcttggaagagtgcgcaagcaggatgtcgaagcgtacgaa
aaaccggcatcaaaaccggctcctcagcaaaagcagcagcctcaggctcaaaaagcacag
caaagctttgacaaacctgttgaagtgcaaaaaatgtcacgccgcagacaaacgattgca
aaacgccttgtagaggtacagcaaacatcagcgatgctgactacatttaatgaagtggac
atgacggctgtcatgaatctcagaaaacgccgcaaagatcaattttttgagcaaaatgaa
gtgaagctcggctttatgtctttcttcacgaaagcggtcgtggctgcattgaaaaaatat
ccgctgttgaatgcagaaattcaaggcgatgagttgatcgttaaaaaattctacgatatc
ggaatcgctgttgctgctgatgaaggtcttgtcgttccggttgtacgggatgcggatcgc
ctgacatttgcaggaatcgaaaaagagatcggcgagcttgcgaaaaaagcaagaaacaat
aaattaacccttagcgagcttcagggaggctccttcacgattacaaacggagggactttc
ggttcattgatgtcaactccaattttaaacagcccgcaagtcggtatactgggcatgcat
aagattcagctgcgccctgtagccattgatgaagagcgtttcgaaaaccgtccgatgatg
tatatcgctttatcttatgatcaccgaattgtagacggtaaagaagcggttggtttcctc
gtgacaatcaaaaatttactggaagatcctgaacagcttttattagaaggataa

DBGET integrated database retrieval system