KEGG   Bacillus subtilis BEST7613: BEST7613_3732Help
Entry
BEST7613_3732     CDS       T02410                                 

Gene name
dfrA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bsub  Bacillus subtilis BEST7613
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bsub00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:bsub00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3913989..3914495)
Genome map
AA seq 168 aa AA seqDB search
MISFIFAMDANRLIGKDNDLPWHLPNDLAYFKKITSGHSIIMGRKTFESIGRPLPNRKNI
VVTSAPDSEFQGCTVVSSLKDVLDICSGPEECFVIGGAQLYTDLFPYADRLYMTKIHHEF
EGDRHFPEFDESNWKLVSSEQGTKDEKNPYDYEFLMYEKKNSSKAGGF
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgatttcattcatttttgcgatggatgccaacaggcttatcggcaaagacaatgatttg
ccgtggcatttgcccaatgatcttgcatactttaagaaaataacatcgggccattcaatc
attatgggccggaaaacatttgaatcgatcggacgtccgcttccaaatcggaaaaatatt
gtcgttacctcagcgccggattcagaatttcagggatgcacggttgtcagttcattaaag
gatgtactggacatttgttcaggccctgaagaatgctttgtgatcggaggggctcagctc
tatacggacctgttcccttatgcggacagactgtatatgacgaaaattcatcacgagttt
gagggtgaccgtcactttcctgaatttgatgaatccaattggaagctggtttcttctgag
caggggaccaaagacgaaaaaaacccgtatgattacgaatttctaatgtatgaaaaaaag
aattcttctaaagcgggaggattttaa

DBGET integrated database retrieval system