KEGG   Bacillus subtilis BEST7613: BEST7613_4040Help
Entry
BEST7613_4040     CDS       T02410                                 

Gene name
glcK
Definition
glucose kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bsub  Bacillus subtilis BEST7613
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bsub00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BEST7613_4040 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BEST7613_4040 (glcK)
   00052 Galactose metabolism
    BEST7613_4040 (glcK)
   00500 Starch and sucrose metabolism
    BEST7613_4040 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    BEST7613_4040 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BEST7613_4040 (glcK)
   00524 Butirosin and neomycin biosynthesis
    BEST7613_4040 (glcK)
Enzymes [BR:bsub01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BEST7613_4040 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(4187994..4188959)
Genome map
AA seq 321 aa AA seqDB search
MDEIWFAGIDLGGTTIKLAFINQYGEIQHKWEVPTDKTGDTITVTIAKTIDSKLDELQKP
KHIIKYIGMGAPGPVDMAAGVVYETVNLGWKNYALKNHLETETGIPAVIENDANIAALGE
MWKGAGDGAKDVILVTLGTGVGGGIIANGEIVHGINGAGGEIGHICSIPEGGAPCNCGKT
GCIETIASATGIVRIAKEKIANAKKTTRLKATEQLSARDVFEAAGENDEIALEVVDYVAK
HLGLVLGNLASSLNPSKIVLGGGVSRAGELLRSKVEKTFRKCAFPRAAQAADISIAALGN
DAGVIGGAWIAKNEWLKHQNC
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggacgagatatggtttgcgggcattgacctgggaggaacgacgattaaactcgctttt
attaatcaatatggcgaaattcagcataagtgggaagttccgacagataaaaccggcgac
acgattactgtcacaattgcaaaaacaatcgacagcaagctggatgagctgcaaaaaccg
aagcacatcatcaaatacatcggaatgggtgcaccaggccctgtagatatggcggcagga
gtggtttatgaaacagtaaatctagggtggaaaaattatgctttgaaaaaccatctggag
acagaaaccggcatcccagctgttatagaaaatgacgcgaatattgctgcgctcggggaa
atgtggaagggagcgggtgatggcgcaaaagacgtcattctcgtgacgcttggcacagga
gttggcggcggcatcattgcaaatggtgaaattgtacatggtataaatggcgccggcgga
gaaatcggccatatttgcagcatccctgaaggcggagcgccctgcaactgcggcaaaacg
ggctgtatcgaaacaattgcgtcagcaaccggaattgtaagaattgcaaaagaaaaaata
gcaaatgctaaaaagacgacacgtttaaaagcaaccgaacaattgtcagcgcgagatgtg
tttgaagcggcgggtgaaaatgatgaaattgcccttgaggtggttgattatgtagccaag
catcttggtttggtgctcggaaatttggcaagctcgcttaatccatccaaaatcgttctt
ggcggcggcgtatcgagagccggagaactgctgagatcaaaagtcgagaaaacattccgc
aaatgcgcgtttccgcgggcagcccaagctgctgatatttcaatcgcagcacttggaaat
gatgccggcgttatcggaggcgcttggatcgctaaaaatgaatggctgaaacatcaaaat
tgttaa

DBGET integrated database retrieval system