KEGG   Bacillus subtilis BEST7613: BEST7613_4250Help
Entry
BEST7613_4250     CDS       T02410                                 

Gene name
yrrC
Definition
exonuclease
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bsub  Bacillus subtilis BEST7613
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bsub03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(4375637..4378033)
Genome map
AA seq 798 aa AA seqDB search
MQQHPDQLKLEEEPYLKGTVNTVIYHNDTNLYTVLKVKVTETSEAIEDKAVSVTGYFPAL
QEEETYTFYGKIVTHPKFGLQFQAEHFKKEIPTTKEGIIQYLSSDLFEGIGKKTAEEIVK
KLGDSAINKILADASVLYDVPRLSKKKADTLAGALQRHQGLEQIMISLNQFGFGPQLSMK
IYQAYESETLEKIQENPYQLVKDVEGIGFGKADELGSRMGLSGNHPERVKAAILYTLETT
CLSEGHTYIETEQLIIDTQSLLNQSAREGQRITEMDAANAIIALGENKDIVIEDGRCYFP
SLFYAEQNVAKRVKHIASQTEYENQFPESEFLLALGELEERMDVQYAPSQKEAIQKALSS
PMLLLTGGPGTGKTTVIRGIVELYGELHGVSLDPSAYKKDEAFPIVLAAPTGRAAKRMSE
STGLPAVTIHRLLGWNGAEGFTHTEDQPIEGKLLIIDEASMLDIWLANHLFKAIPDHIQI
IIVGDEDQLPSVGPGQVLRDLLASQVIPTVRLTDIYRQAEGSSIVELAHQMKNGLLPNNL
TAPTKDRSFIRCGGSQIKEVVEKVVANALKKGYTAKDIQVLAPMYRGKAGINELNVMLQD
ILNPPKEKRRELKFGDVVYRTGDKILQLVNQPENNVFNGDIGEITSIFYAKENTEKEDMA
VVSFDGNEMTFTKKDFNQFTHAYCCSIHKSQGSEFPIVVLPVVKGYYRMLRRNLLYTAIT
RAKKFLILCGEEEALEWGVKNNDATVRQTSLKNRLSVQVEEMDAELEALQKELPFSVHDA
NIGMEGITPFDFMKEEQQ
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
gtgcagcagcatccggatcagcttaaactggaggaagagccctatttaaaagggacagtc
aacacagtcatctatcataatgacaccaatttatatacggttctgaaagtgaaagtcaca
gagacctccgaagccattgaagataaagccgtatccgtgacgggctacttccctgcgctt
caagaagaagagacctacacgttttacggaaagatcgtaacccatccaaaattcgggctc
caatttcaggcggagcatttcaaaaaggagattccaacgactaaggaaggcatcattcaa
tatttatcgagtgatttattcgaggggatcggcaaaaaaacagctgaagaaattgtgaaa
aagctgggcgacagcgccattaataaaatattggctgatgcttcagtgctttatgatgtt
cccagactctcaaaaaagaaagcagacacgctggctggcgcattgcagcggcatcaggga
ctggagcaaatcatgatttccttgaatcagtttggctttggcccgcagctgtctatgaaa
atctatcaagcctatgaatccgagacgcttgaaaagattcaggaaaatccttatcagctt
gtgaaggatgtagaaggcatcgggtttggaaaagcggatgagctgggcagcagaatgggt
ctttcgggtaatcatcctgagcgggtaaaagctgctattttgtacacgcttgaaacgact
tgtctgtcagaggggcacacgtacatagaaacggaacagctgatcatcgacactcaatca
ctgttaaaccagtcagcaagggaagggcagcgcattacagaaatggatgccgctaacgca
attattgcccttggagaaaataaagacattgtcatagaagatggccgctgttattttcct
tcgctgttttacgcagaacaaaacgttgcaaagcgtgtgaaacatatcgctagccaaacc
gaatatgagaaccagtttcccgaatcagagtttttgctcgcgttgggagaactggaagaa
cggatggacgttcagtatgcccccagccagaaggaagcgattcaaaaagccctttcctcg
ccgatgcttcttttaacaggcggcccgggaacaggaaaaacgacggtaatcagagggatt
gtcgagctctacggagagcttcacggtgtgtcactagacccgtcagcttataaaaaggat
gaagcttttccgattgttttggccgctccgacagggagagcagcaaaacggatgagtgaa
tcaacgggactccctgcagttacgatacacaggctgcttggctggaacggcgctgaaggc
tttactcatacagaggatcagccgatcgaagggaagctgttaattatcgatgaagccagt
atgcttgatatatggctggcgaatcatttgttcaaggcgatccctgatcatatacaaatc
atcattgtcggagacgaagaccagctgccttccgtcggtccgggacaagtgctcagagac
ctgctggcatcccaggtgattccgactgtgagactgacagacatctatcgccaggcagaa
gggtcatcaatcgtcgagcttgcccaccagatgaaaaatggattgctgccgaacaatttg
actgccccgacaaaggaccgttcctttattcgctgcggcgggtcgcaaatcaaagaagta
gttgagaaggttgtcgccaatgcattgaaaaaaggctatacagcaaaggacattcaggtc
ctcgctccgatgtacagaggaaaagccggcattaatgaattgaatgtgatgctgcaggac
attttaaatcctcctaaagaaaaacggagagaattgaagttcggggatgttgtctacaga
accggagataaaattttgcagcttgtcaatcagccggaaaacaatgtgttcaacggagat
attggcgaaatcacgtcgatattttatgcaaaggaaaatacagaaaaagaagacatggcc
gtcgtttcttttgacggcaatgaaatgacatttacgaaaaaagattttaatcaatttacc
catgcgtattgctgttctattcataaatcgcagggaagtgaatttccgattgtggttttg
cctgttgtgaaaggctattatagaatgctcagaagaaaccttctttataccgcgattaca
agagcgaagaaatttctcattttatgcggggaagaggaggcgctggagtggggcgtgaaa
aataatgatgcaactgtcagacagacctccttgaaaaacaggctgtccgtacaggttgag
gaaatggatgccgagcttgaagctttgcaaaaagagctcccgttcagcgtacacgacgcc
aacattggcatggaaggcattacaccattcgattttatgaaagaagaacagcaataa

DBGET integrated database retrieval system