KEGG   Bacillus subtilis BEST7613: BEST7613_4415Help
Entry
BEST7613_4415     CDS       T02410                                 

Gene name
gst1
Definition
glutathione S-transferase
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
bsub  Bacillus subtilis BEST7613
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bsub00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BEST7613_4415 (gst1)
Enzymes [BR:bsub01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BEST7613_4415 (gst1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4543338..4544153
Genome map
AA seq 271 aa AA seqDB search
MLELHQFELSQYSEKVRLILDFKGLDYRTVEVVPGVGQLDLLRLSGQTKVPVLKDGDIVI
ADSTEIALYLDRKYPENSLLPHDPVQRGQCLLMEEWADESIGLKGRVAMVGALNQNPGLR
ASILPKQTPGIFKNLVSAVPPAMLDLLGSGVGFGGDAVKEAMRGLHQDLEALTLILQHQP
YLIGDRPTLADLTVAALSMVIKIPGGNYLNIAQELKGKGIPGLADNSAYSAFFEWRDRLY
REYRRSHQQDNNQNNGSGSSNNSSPTTITIE
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgcttgagcttcatcagtttgaactgtcccaatattcggaaaaagtccgcctgattctc
gactttaaagggttggattatcggacagtggaagtggtgccgggggttggtcagctcgat
ttgctccgtctttctggacaaacaaaggttccagtgctcaaggatggggacattgtcatt
gcagattcgacggaaattgccctctacctagaccgtaaataccccgaaaattccctttta
ccccacgatccggtgcaacggggacaatgcttgctgatggaagaatgggccgacgaatcc
attggtctgaagggtcgggttgccatggtgggggcgttgaaccaaaatcctggtctgcgg
gcttctattttgcccaaacaaaccccaggcattttcaaaaatttagtcagtgcagtaccc
ccggctatgttagacctattgggcagtggcgttggttttggtggtgatgcggtcaaggaa
gccatgcggggcttgcatcaggacttggaggctttaactctgattctgcaacatcagccc
tacctaattggcgatcgcccaacgttggcagatttaacggtggcggcattgagtatggtg
atcaaaatccccggcggaaattacttaaacattgcccaggagttgaagggtaagggcatt
cctggcttggcggataacagtgcctacagtgcattttttgaatggcgcgatcgcctttat
cgggaatatcgccgcagtcatcaacaggacaataatcagaacaacggcagcggtagcagt
aacaatagttcccccaccacaatcaccattgagtag

DBGET integrated database retrieval system