KEGG   Bacillus subtilis BEST7613: BEST7613_4767Help
Entry
BEST7613_4767     CDS       T02410                                 

Definition
hypothetical protein
Orthology
K11331  
cation efflux system protein involved in nickel and cobalt tolerance [EC:3.2.1.17]
Organism
bsub  Bacillus subtilis BEST7613
Pathway
Two-component system
Brite
KEGG Orthology (KO) [BR:bsub00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BEST7613_4767
Enzymes [BR:bsub01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     BEST7613_4767
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(4951147..4951647)
Genome map
AA seq 166 aa AA seqDB search
MEGGDPYIRALMRTISASESNAKNPYVLLYGGQHTHDLSRHPNACIAIKTDVNQGHCSTA
AGRYQFLTKTWQEKAALYHPQRHLGKSHYNFEPEFQDLVTYRWLTDKHHWGMDFSTQLQQ
GNIEQVLKKLSGTWTSLGYGIEDNRMTASLPKIYQKLLAEELDQAN
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atggaaggaggagatccttacattagagctttaatgcggacaatttcagccagtgaatct
aatgctaaaaatccctacgttttactctatggcggtcaacatacccatgatttaagtcgc
catcccaatgcttgtattgccatcaaaacagatgttaaccaagggcattgctccacagcg
gcaggacgttatcaatttttgactaagacttggcaggaaaaagcggctttgtatcaccct
caacgtcatttgggaaaatcacactataactttgagcctgaatttcaggatttagtaacc
tatcgatggttgaccgataaacaccactggggcatggacttttccacccaattacaacag
ggaaatatcgaacaagtgttgaaaaaactttctggcacttggacaagtttgggttacggc
attgaagacaatagaatgaccgcttctttacccaaaatttatcaaaaactattagcagaa
gaacttgaccaagctaattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system