KEGG   Bacillus subtilis BEST7613: BEST7613_4973Help
Entry
BEST7613_4973     CDS       T02410                                 

Gene name
desC
Definition
acyl-CoA desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
bsub  Bacillus subtilis BEST7613
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bsub00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BEST7613_4973 (desC)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    BEST7613_4973 (desC)
Enzymes [BR:bsub01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     BEST7613_4973 (desC)
Lipid biosynthesis proteins [BR:bsub01004]
 Desaturase
  First
   BEST7613_4973 (desC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5183422..5184267
Genome map
AA seq 281 aa AA seqDB search
MTAALPNDSKPKLTPAWTVIFFFTSIHLVALLAFLPQFFSWKAVGMAFLLYVITGGIGIT
LGFHRCISHRSFNVPKWLEYIFVICGTLACQGGVFEWVGLHRMHHKFSDTTPDPHDSNKG
FWWSHIGWMMFEIPAKADIPRYTKDIQDDKFYQFCQNNLILIQVALGLILFALGGWPFVI
WGIFVRLVFVFHFTWFVNSATHKFGYVSHESNDYSRNCWWVALLTFGEGWHNNHHAYQYS
ARHGLQWWEVDLTWMTIKFLSLLGLAKDIKLPPETAMANKA
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgactgctgctcttcccaacgattccaagcccaagttgactccagcttggactgtgatc
ttcttttttacctccattcatttggtggccctgttggctttcctgccccagtttttcagt
tggaaagcagtggggatggctttcttgctctatgtaattaccggcggcattggcattact
ttaggttttcaccgttgtatttcccaccgcagtttcaatgttcctaaatggttagagtat
attttcgtaatctgtggcaccctagcctgtcaggggggcgtatttgagtgggtcggctta
caccgtatgcaccacaaattttctgacaccaccccggatccccacgattctaataagggt
ttttggtggagtcacatcggctggatgatgtttgaaattcctgctaaagctgatattccc
cgctacaccaaggatatccaagacgataaattttatcaattttgccagaataatctaatt
cttatccaggtcgccctaggcttgattttatttgccttagggggctggcccttcgttatt
tggggcatttttgtccgcctagtgtttgttttccacttcacttggtttgtcaacagtgcc
acccataagttcggctacgttagccatgaatccaatgattattcccgcaattgttggtgg
gtagcattgttaactttcggtgaaggttggcacaataatcaccacgcctatcagtactct
gctcgccatggtttgcaatggtgggaagtggatttaacttggatgaccattaaattccta
tctttgctggggttagccaaggatattaaacttcctccggaaactgcgatggccaacaaa
gcctag

DBGET integrated database retrieval system