KEGG   Bacillus subtilis BEST7613: BEST7613_4973Help
Entry
BEST7613_4973     CDS       T02410                                 

Gene name
desC
Definition
acyl-CoA desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
bsub  Bacillus subtilis BEST7613
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:bsub01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:bsub01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5183422..5184267
Genome map
AA seq 281 aa AA seqDB search
MTAALPNDSKPKLTPAWTVIFFFTSIHLVALLAFLPQFFSWKAVGMAFLLYVITGGIGIT
LGFHRCISHRSFNVPKWLEYIFVICGTLACQGGVFEWVGLHRMHHKFSDTTPDPHDSNKG
FWWSHIGWMMFEIPAKADIPRYTKDIQDDKFYQFCQNNLILIQVALGLILFALGGWPFVI
WGIFVRLVFVFHFTWFVNSATHKFGYVSHESNDYSRNCWWVALLTFGEGWHNNHHAYQYS
ARHGLQWWEVDLTWMTIKFLSLLGLAKDIKLPPETAMANKA
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgactgctgctcttcccaacgattccaagcccaagttgactccagcttggactgtgatc
ttcttttttacctccattcatttggtggccctgttggctttcctgccccagtttttcagt
tggaaagcagtggggatggctttcttgctctatgtaattaccggcggcattggcattact
ttaggttttcaccgttgtatttcccaccgcagtttcaatgttcctaaatggttagagtat
attttcgtaatctgtggcaccctagcctgtcaggggggcgtatttgagtgggtcggctta
caccgtatgcaccacaaattttctgacaccaccccggatccccacgattctaataagggt
ttttggtggagtcacatcggctggatgatgtttgaaattcctgctaaagctgatattccc
cgctacaccaaggatatccaagacgataaattttatcaattttgccagaataatctaatt
cttatccaggtcgccctaggcttgattttatttgccttagggggctggcccttcgttatt
tggggcatttttgtccgcctagtgtttgttttccacttcacttggtttgtcaacagtgcc
acccataagttcggctacgttagccatgaatccaatgattattcccgcaattgttggtgg
gtagcattgttaactttcggtgaaggttggcacaataatcaccacgcctatcagtactct
gctcgccatggtttgcaatggtgggaagtggatttaacttggatgaccattaaattccta
tctttgctggggttagccaaggatattaaacttcctccggaaactgcgatggccaacaaa
gcctag

DBGET integrated database retrieval system