KEGG   Bacillus subtilis BEST7613: BEST7613_5027Help
Entry
BEST7613_5027     CDS       T02410                                 

Definition
endo-1,4-beta-glucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bsub  Bacillus subtilis BEST7613
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsub00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BEST7613_5027
Enzymes [BR:bsub01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     BEST7613_5027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(5238080..5241292)
Genome map
AA seq 1070 aa AA seqDB search
MNSILSPITVAVGGSLWWNGFTADFTITNTSTTSLSNWTYTFDTVHKISGNPWGATFTSV
DLGNGITRYTLTGAGWASSIPPGGSVTIGFNGTQGTAIGNSGSLTSALLFTDVNANTGGT
GGEHQHPDPIPPTDPVVDPTPNPGTGRVFAANPAAADIVGFNPAVDRLDFGDVSVHNLIL
GKTSTGKVAIINPWAWTPEFQIIRGVSFDDLTAANFGIVQNEHLRQDIGGVLSWELGLGA
RNSNTVYVRSHEYGVQERIENFNPATMKLSFLYYGTRERLTVSDTPEGLLIATQPTGQTL
LLVGVTRSQLIPANLEFHHDQVVEDRLEDAFGVTVEQVTVVSRTGLATPQGPAGQITDGH
QSRPGNGLTPIGGGEFSGGAGGHGSGHDHGDHDHGGGMDHGSDPGDGMGGGTTNPPVTDP
VTPPPTDPVSPTSPFTVTVGGNRWWNGFTAELTVTNVSGTKLNSWSFTFDTVHKISGSPW
GATVQSTDLGGGITRYVVTGSEWAASIAPGSSVKVGFNGTQGTAIANDGALTADLLFLGG
GIVGQPSTGSGGNTGGTPTNPNPPTDPINPNPNPVDPVDPPAIANGDHNYGEALQKSFLF
YEANRSGDLDESTKRIDWRGDSGLRDGRDGIYFGGQSSGNLQAGLSLDLTGGYHDAGDHG
KFGLPLASTLTTLAWGGVEFTDGYQTSGQMDDLLATIRWGTDYLLKAHVTNANGETVFFV
AQVGNASADHSLWSAPESQTIARPAMAVTANKPGSDVAAGSAAALAAASILFREAGDFAY
ADELLVNAQSLYRFADTYRGKYSDSIPEVRNYYNSWSGYEDELAYGAAWLSRAVNSAGGD
GSAYLQKALNIYNSDIGGLSRGWTHNWDDASYGVAVILAQDTGNQAIKQDVTRWLDAWVN
GTDGVQITDGGLRFISQWGSLRYAANTAMLAAVYSDGLTDPTGKYAQLAQDTVDYILGSN
PRNASYMVGYGNDFPQQPHHRAASGVGWDGFRNGLPNEHILFGALVGGPTAANDFSYNDS
RDDYISNEVAIDYNAGLTGALAWSVEQFGGNPLTAAQLNALPGISAPQGM
NT seq 3213 nt NT seq  +upstreamnt  +downstreamnt
atgaatagcatcctttcccccattaccgtagcggtgggcggctccctctggtggaatggc
ttcaccgctgatttcaccatcaccaacacttctaccactagcctcagcaattggacttac
accttcgacactgtccacaaaatttccggtaatccctggggcgcaacttttaccagcgtg
gatttgggcaatggcatcacccgctacacattaactggggctggttgggcatcgagtatt
ccccccggtggttccgtcaccattggttttaatggtacccagggaacggcgatcggtaat
agcggctctttgacttctgctttattattcaccgacgttaatgccaatactggggggact
gggggagaacatcagcatccagatcctattcctcccacggatccagtcgtagatcccact
cctaaccccggcactggtagagtatttgctgccaatcctgcggccgccgatattgtcggt
ttcaatcccgctgtggataggttggattttggcgatgtgtcggtgcataacctcatcctt
ggtaaaaccagcaccgggaaagtggccatcattaatccctgggcttggactcctgagttt
cagattatccggggagttagctttgatgatttgacagcggccaattttggcattgtgcag
aacgagcatctgcggcaggacattggcggagtcctcagttgggaattaggtttaggggca
agaaatagtaatacggtttatgtccgttcccatgagtatggggtgcaggaacggatcgag
aattttaaccccgccaccatgaagttgagctttctctactacggcactagggaaagatta
accgttagcgatacgccggagggtttattaattgccacccaacccacgggacaaactttg
ttgctggtgggggtaacccgcagtcaactcattccggctaatttggaatttcaccatgac
caggtggtggaagaccgcttagaagatgcctttggggtcactgtcgagcaagttaccgtt
gttagtcgcactggtttagccactccccaggggccagcgggacaaattaccgatggtcat
cagagcaggcccggtaatggtttaactcccattggtggtggggaatttagcggcggtgct
gggggtcatggtagtggccatgatcacggtgaccatgaccatggcggcggtatggaccac
ggttctgatcccggtgatggcatggggggaggcactaccaatcctccggtcaccgatcca
gtcacgcccccacccaccgatcctgtttctcccactagtcctttcactgtcacggtggga
ggtaatcgttggtggaatggctttacggcggagttgactgtaactaacgtttcgggaact
aagcttaatagctggagctttacctttgatacggtgcataaaatttccggtagcccctgg
ggagccactgtccaaagtacagatttaggaggaggcattacccgttatgtggtcaccggc
agtgaatgggccgcttccattgcccctggcagttcggtcaaagttggctttaacggtacc
caaggaacggcgatcgccaacgacggggccttaaccgcagatttactctttctcggtggc
ggtatagttggtcaacccagcactggctctggtggtaatactggaggaactcccactaat
cccaatccccccactgaccccattaatcctaaccccaatcctgttgatcccgtcgatccc
ccggcgatcgccaatggggaccataattacggcgaagcgttgcaaaaatctttcctgttt
tacgaagccaaccgttctggagacttagacgaatccactaaacgcattgactggcgggga
gattccgggttaagggatggccgggatggcatttattttggtggacaaagtagcggtaat
ttacaagcaggtttaagcctggatttaaccggtggttatcatgatgcgggggaccacggc
aaatttggcttaccccttgcttccacattaaccaccctggcctggggcggcgtggaattt
acggacggttaccaaaccagtggccaaatggatgatctccttgcaaccatacggtggggg
acggactatctactcaaagctcacgttaccaacgccaatggagagacagtattttttgtc
gcccaggtgggtaacgcttcagcagatcattccctctggagtgccccggaaagccaaacc
attgcccggccagccatggcggttactgctaataaacctggttccgatgtggcggcgggt
tcagcggcggccctggcggcggcttctattctgttccgagaagcgggggattttgcctat
gcggatgaattgttagtcaatgcccaatctttatatcgatttgcggacacctaccggggt
aaatattccgactctattcccgaagtgcggaactattacaactcctggagtggctatgaa
gatgagttggcctatggggcagcgtggttgtcccgggcggttaatagtgcagggggggat
ggttctgcctatctgcaaaaggcattgaacatttacaacagtgacattgggggattgagt
cggggttggacccacaattgggacgatgcctcctatggtgtggcggtaatattagcccaa
gacaccggtaatcaagcgattaaacaagatgtgacccgctggctagatgcttgggtcaat
ggcaccgatggggtgcaaatcactgacggcggtttgcggtttattagccaatggggttcc
ctacgctacgcggccaatacggcaatgctggcagcggtctattccgacggcttaaccgat
cccactggtaagtatgcccagttagcccaggacacagtggactatattttaggcagtaat
ccccgcaatgctagctatatggtgggttacggcaatgattttccccaacagccccaccat
cgggcagcttcgggagtgggctgggacggtttccgcaacggcttgcccaatgagcatatt
ttgttcggtgctttggtgggcggtcccactgcggccaatgactttagttataacgactcc
cgggatgactacatcagcaacgaagtggccattgattacaatgcaggcttaacgggagca
ttggcttggtcggtggaacagtttgggggtaatcccctcacggcggcccagttgaatgct
ttacctggtatttcagcgccccaagggatgtag

DBGET integrated database retrieval system