KEGG   Bacillus subtilis BEST7613: BEST7613_5724Help
Entry
BEST7613_5724     CDS       T02410                                 

Gene name
odhB
Definition
branched-chain alpha-keto acid dehydrogenase E2
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bsub  Bacillus subtilis BEST7613
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:bsub01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bsub00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:bsub00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bsub00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5995595..5996896
Genome map
AA seq 433 aa AA seqDB search
MIYDIFMPALSSTMTEGKIVSWTKSPGDKVEKGETVLVVESDKADMDVESFNEGYLAAIL
VPAGEEAPVGATLGLVVETEAEIAEAQAKAGSGGGSSAAPTATPAPQQPEPVAIASATAI
ETTPAPSSNGNGKGSGRIIASPRAKKLAKELKVDLATIAGTGPHGRIVAADIESAAGKPV
TASIAAPSAPAPKTSPAPTPRVTSTPSVPVGQTVPLTTFQKALVQNMVAAMAAPTFRVGY
TITTDGLDQLYKQIKGKGVTMTALLAKAVALALKKHPIVNASYTDQGIIYHKDVNIALAV
AMPDGGLITPVLQNADQVDIYSLSRRWKELVERARAKQLQPEEYSTGTFTISNLGMFGVD
RFDAILPPGQGGILAVGASRPQVVANEEGLIGTKRQMAVNVTCDHRVIYGAHAAAFLKDL
AVIIEENAQSLTM
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgatttacgacattttcatgcccgccctgagttccaccatgaccgaggggaaaattgtt
tcttggactaagtcccccggcgacaaagtggaaaaaggtgaaactgtcttggtggtggaa
tcggacaaagcagatatggacgtggagtcctttaacgaaggttacctagccgccattcta
gttccagcaggggaagaagctcccgtgggggcaacccttggcctagtggtggaaacggaa
gcggaaattgccgaagcccaagctaaagctggctctggtggtggttctagtgcggctccg
actgcaaccccagccccccaacaacctgaaccagtggcgatcgccagtgcaactgccata
gagacaactccggcccctagcagtaacggcaatggcaaaggcagtgggcgaattattgct
tccccccgggcgaaaaaactagccaaagagttaaaagttgatttagctaccattgctggc
actggcccccacggcagaattgtggccgcagatattgaaagtgccgctggtaaacccgtc
actgcttccatcgctgcccccagtgccccagctcctaaaacatcccctgcccctactcca
agggtaacctctacccccagtgttcccgtcggccagacagtacccctgaccactttccaa
aaagctttggtgcaaaatatggtggccgccatggccgctcctacattccgagtgggctac
accatcaccaccgatggactggatcaactttataaacaaatcaaaggcaaaggggtgact
atgacggccctgttggctaaagctgtggctctggccttgaaaaaacatcccattgtcaac
gccagctacactgaccaaggcatcatctaccacaaggatgtcaacattgctctggccgta
gccatgcccgatggcggtttaattactccggtgttgcaaaatgcagaccaagtagatatc
tactccctctcccgccgatggaaagaattggtggaacgggcccgggctaagcagttacag
cctgaagaatacagcactggcactttcactatttctaacctgggtatgtttggggtagac
cgatttgatgccattctaccgccgggtcaagggggaattttagcggtgggtgcttcccgt
ccccaagtagtggccaatgaggaaggtttgattggtaccaaacgacaaatggcggttaat
gtaacctgtgaccatcgggtaatttatggggcccatgccgccgctttcctgaaggatttg
gctgtcattattgaagagaatgcccagtctttgactatgtaa

DBGET integrated database retrieval system