KEGG   Bacillus subtilis BEST7613: BEST7613_5967Help
Entry
BEST7613_5967     CDS       T02410                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
bsub  Bacillus subtilis BEST7613
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:bsub03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(6265381..6266196)
Genome map
AA seq 271 aa AA seqDB search
MTLEQTIGGGEVLLDRSLAYPVSVEDFQKQITGCRLVGWQRRGKYLLGELRSNQAPGPAG
WLGCHLRMTGQLLWTERDQQRPRHTRVVLHFEGGWELRFVDTRTFGKVWLLPGDRPWAEV
MTGLGQLGPEPFGADFTAEYLYEKLKSSRRPLKNALLDQRLVAGLGNIYADEVLFFCGFH
PTMASNQVSLQDCELIHQQIQATLTAAIEAGGTSFSDYRQVTGINGNYGGMAQVYGREGE
PCRHCGTVIAKIKLGGRSAHFCPQCQPKLER
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
ttgaccctggagcagaccatcgggggaggggaagtgttgcttgatcgcagtcttgcctac
cccgtttctgttgaggattttcagaagcaaattaccggttgtcgtttggtgggctggcaa
cggcggggaaagtatttgctgggggaacttagaagcaatcaagccccagggccggcggga
tggttgggatgccatttacgtatgacagggcagttactctggacagaacgggatcagcag
agaccacgacacactagggtggtgctccactttgagggcgggtgggagttacgttttgtg
gatacccgcacctttggcaaagtctggctcctaccaggcgatcgcccttgggctgaagta
atgacggggctgggacagttggggccagaaccctttggggcggattttacggcggaatat
ctctacgaaaagctgaaatccagtcgccgccctttaaaaaatgccctgctggatcaacgg
ttggtggcaggcttgggtaatatttatgccgatgaagtcttatttttttgcggcttccat
cccaccatggcgagtaatcaggtgagtttgcaggactgtgaactgatacatcaacaaatt
caagccactttaacagcggccattgaggctggaggcactagtttcagcgattatcgccag
gtgactggtatcaatggtaattatggcggtatggcccaggtctatggtcgggaaggagaa
ccctgtcgtcattgtggtacagtgatcgccaaaattaaattgggagggcgatcggcccac
ttttgtccccagtgtcagccaaaattagagcggtga

DBGET integrated database retrieval system