KEGG   Bacillus subtilis BEST7613: BEST7613_6186Help
Entry
BEST7613_6186     CDS       T02410                                 

Gene name
ytpA
Definition
phospholipase component of bacilysocinsynthesis orexport
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bsub  Bacillus subtilis BEST7613
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:bsub00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(6496772..6497551)
Genome map
AA seq 259 aa AA seqDB search
MWTWKADRPVAVIVIIHGASEYHGRYKWLIEMWRSSGYHVVMGDLPGQGTTTRARGHIRS
FQEYIDEVDAWIDKARTFDLPVFLLGHSMGGLVAIEWVKQQRNPRITGIILSSPCLGLQI
KVNKALDLASKGLNVIAPSLKVDSGLSIDMATRNEDVIEADQNDSLYVRKVSVRWYRELL
KTIESAMVPTEAFLKVPLLVMQAGDDKLVDKTMVIKWFNGVASHNKAYREWEGLYHEIFN
EPEREDVFKAARAFTDQYI
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgtggacctggaaagcagacagacctgttgccgtgattgtaatcattcacggggcaagt
gaatatcacggacgatataaatggctgattgaaatgtggcggtcttcgggttatcacgtt
gtcatgggcgatttgcctggacagggaacaacgacaagagcgagagggcatattcgctcg
tttcaagaatacattgatgaagtagatgcttggatagataaagcgcgaacctttgatctt
ccggtttttcttctaggtcacagcatgggcggtctggtcgcgattgaatgggttaaacag
caaagaaatccccggattacgggaattattttatcatcaccgtgtctcggactgcaaatt
aaagtgaataaagcgcttgatcttgcatcaaaaggcctgaatgtcatcgctccgtcactt
aaggttgattcgggattatcaattgatatggcgacgcgcaatgaggacgtcatcgaagct
gaccaaaatgattcgttatacgtcaggaaagtttctgtcagatggtacagagagctttta
aagacaattgaatcggcaatggtgccgacagaggcatttttgaaagttccgcttcttgtg
atgcaagccggtgatgacaagcttgttgacaaaacgatggtcatcaagtggtttaatggt
gttgcttctcataataaagcatacagagagtgggaagggctttaccatgagatcttcaat
gaacccgagagagaagatgtttttaaagcagcaagagcgtttactgatcaatatatttga

DBGET integrated database retrieval system