KEGG   Bacillus subtilis BEST7613: BEST7613_6186Help
Entry
BEST7613_6186     CDS       T02410                                 

Gene name
ytpA
Definition
phospholipase component of bacilysocinsynthesis orexport
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bsub  Bacillus subtilis BEST7613
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bsub00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BEST7613_6186 (ytpA)
Enzymes [BR:bsub01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BEST7613_6186 (ytpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(6496772..6497551)
Genome map
AA seq 259 aa AA seqDB search
MWTWKADRPVAVIVIIHGASEYHGRYKWLIEMWRSSGYHVVMGDLPGQGTTTRARGHIRS
FQEYIDEVDAWIDKARTFDLPVFLLGHSMGGLVAIEWVKQQRNPRITGIILSSPCLGLQI
KVNKALDLASKGLNVIAPSLKVDSGLSIDMATRNEDVIEADQNDSLYVRKVSVRWYRELL
KTIESAMVPTEAFLKVPLLVMQAGDDKLVDKTMVIKWFNGVASHNKAYREWEGLYHEIFN
EPEREDVFKAARAFTDQYI
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgtggacctggaaagcagacagacctgttgccgtgattgtaatcattcacggggcaagt
gaatatcacggacgatataaatggctgattgaaatgtggcggtcttcgggttatcacgtt
gtcatgggcgatttgcctggacagggaacaacgacaagagcgagagggcatattcgctcg
tttcaagaatacattgatgaagtagatgcttggatagataaagcgcgaacctttgatctt
ccggtttttcttctaggtcacagcatgggcggtctggtcgcgattgaatgggttaaacag
caaagaaatccccggattacgggaattattttatcatcaccgtgtctcggactgcaaatt
aaagtgaataaagcgcttgatcttgcatcaaaaggcctgaatgtcatcgctccgtcactt
aaggttgattcgggattatcaattgatatggcgacgcgcaatgaggacgtcatcgaagct
gaccaaaatgattcgttatacgtcaggaaagtttctgtcagatggtacagagagctttta
aagacaattgaatcggcaatggtgccgacagaggcatttttgaaagttccgcttcttgtg
atgcaagccggtgatgacaagcttgttgacaaaacgatggtcatcaagtggtttaatggt
gttgcttctcataataaagcatacagagagtgggaagggctttaccatgagatcttcaat
gaacccgagagagaagatgtttttaaagcagcaagagcgtttactgatcaatatatttga

  All links  
No link information was found.   
DBGET integrated database retrieval system