KEGG   Bacillus subtilis BEST7613: BEST7613_6220Help
Entry
BEST7613_6220     CDS       T02410                                 

Gene name
ytdA
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bsub  Bacillus subtilis BEST7613
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bsub00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BEST7613_6220 (ytdA)
   00052 Galactose metabolism
    BEST7613_6220 (ytdA)
   00500 Starch and sucrose metabolism
    BEST7613_6220 (ytdA)
   00520 Amino sugar and nucleotide sugar metabolism
    BEST7613_6220 (ytdA)
Enzymes [BR:bsub01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BEST7613_6220 (ytdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(6528845..6529663)
Genome map
AA seq 272 aa AA seqDB search
MIKKAIIPAGGFGTRNLPVTKVIPKEMFPVGSKPVIHYLVEELKESGIEDILMVVSSHKN
LIVDYFDSSLALEAFLASKNKLHLLREHPIPDIRIHYVRQPYAKGLGDAISFGKQFAGGE
PFAVVLPDDLIFSANQPALGQLIEAYTKYQSSVIGLKETKTEDLHHYGVIKGEPVEKGLY
RIQDIVEKPKQNPPSHFAAAGRYIFTPDIFNELEALEADSGGEVQVTDAIKASLGACTVY
GKLLEGERYDIGLQKDYLKLIYDMLKTEKNPQ
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaaagcgatcattcctgcaggcggattcggcacgagaaatctgccggtgacg
aaggtgattccgaaagaaatgtttccggtaggatctaagcctgtgattcattatcttgtt
gaagaattaaaggagtcaggcattgaggacattttgatggttgtatcgagccataaaaat
ctgattgtcgactattttgattcctctttggcacttgaggcttttttggcctctaagaat
aaactgcatttacttagagagcatcccattccggatatacggattcactatgtgcggcag
ccttatgcaaagggtcttggcgacgccatttctttcggaaagcaatttgcaggaggagag
ccttttgccgtcgttttgccagatgatctgattttttccgccaatcagccggctttgggg
cagctgattgaagcgtatacgaaatatcagtccagtgtgatcggcttaaaagaaacaaaa
acggaggatttacatcattacggggtgataaaaggggagcctgttgaaaaagggctttat
cgcatacaggatattgtggaaaagcctaaacaaaaccctccgtctcattttgccgcagca
gggcgttatattttcacaccggatatttttaatgagctggaggcattagaagctgatagc
ggaggagaagtgcaggtaacggatgcgataaaagcttcgctcggggcatgtaccgtatac
gggaaattgctagagggcgagcggtatgacatcggcctgcaaaaggattatctgaagctg
atttacgatatgctgaaaacggaaaagaacccccaataa

DBGET integrated database retrieval system