KEGG   Bacillus subtilis BEST7613: BEST7613_6509Help
Entry
BEST7613_6509     CDS       T02410                                 

Gene name
yvaK
Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
bsub  Bacillus subtilis BEST7613
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(6828946..6829692)
Genome map
AA seq 248 aa AA seqDB search
MSMKVVTPKPFTFKGGDKAVLLLHGFTGNTADVRMLGRYLNERGYTCHAPQYEGHGVPPE
ELVHTGPEDWWKNVMDGYEYLKSEGYESIAACGLSLGGVFSLKLGYTVPIKGIVPMCAPM
HIKSEEVMYQGVLSYARNYKKFEGKSPEQIEEEMKEFEKTPMNTLKALQDLIADVRNNVD
MIYSPTFVVQARHDHMINTESANIIYNEVETDDKQLKWYEESGHVITLDKERDLVHQDVY
EFLEKLDW
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagcatgaaagttgtgacaccaaaaccatttacatttaaaggcggagacaaagcggtg
cttttgctgcatggctttacaggaaatacagcggatgtaaggatgctgggacgatatttg
aatgaacgcggctatacgtgccacgcgcctcaatatgaaggacatggcgtcccgcctgaa
gaacttgtacatacggggcccgaagactggtggaaaaacgtaatggatggctatgaatat
ttaaaatctgaaggttatgagagcattgctgcctgcggactgtcgcttggcggggttttt
tcgctgaaattgggttacactgtacccataaagggaattgtcccaatgtgcgcaccgatg
catattaagagtgaagaggtcatgtatcaaggcgttctttcatacgctcgcaattacaaa
aagtttgaggggaaaagcccggagcaaattgaagaggaaatgaaagaattcgaaaaaacg
ccgatgaataccctcaaggcgctgcaagacttaattgctgatgtgcggaataatgtcgat
atgatttattcaccgacatttgtggtgcaggcccgtcatgaccacatgattaataccgaa
agcgccaatattatttacaacgaagtggaaactgatgataaacagctgaaatggtacgag
gaatcagggcatgtcattacactcgacaaagaacgtgacctcgtccatcaggatgtgtat
gaatttttagagaagctcgattggtaa

DBGET integrated database retrieval system