KEGG   Bacillus subtilis BEST7613: BEST7613_6713Help
Entry
BEST7613_6713     CDS       T02410                                 

Gene name
gtaB
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bsub  Bacillus subtilis BEST7613
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:bsub00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bsub00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bsub00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bsub00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7035610..7036488
Genome map
AA seq 292 aa AA seqDB search
MKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIIEEAVEAGIEDIIIVTGKS
KRAIEDHFDYSPELERNLEEKGKTELLEKVKKASNLADIHYIRQKEPKGLGHAVWCARNF
IGDEPFAVLLGDDIVQAETPGLRQLMDEYEKTLSSIIGVQQVPEEETHRYGIIDPLTSEG
RRYQVKNFVEKPPKGTAPSNLAILGRYVFTPEIFMYLEEQQVGAGGEIQLTDAIQKLNEI
QRVFAYDFEGKRYDVGEKLGFITTTLEFAMQDKELRDQLVPFMEGLLNKEEI
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtacgtaaagccataattccagcagcaggcttaggaacacgttttcttccg
gctacgaaagcaatgccgaaagaaatgcttcctatcgttgataaacctaccattcaatac
ataattgaagaagctgttgaagccggtattgaagatattattatcgtaacaggaaaaagc
aagcgtgcgattgaggatcattttgattactctcctgagcttgaaagaaacctagaagaa
aaaggaaaaactgagctgcttgaaaaagtgaaaaaggcttctaacctggctgacattcac
tatatccgccaaaaagaacctaaaggtctcggacatgctgtctggtgcgcacgcaacttt
atcggcgatgagccgtttgcggtactgcttggtgacgatattgttcaggctgaaactcca
gggttgcgccaattaatggatgaatatgaaaaaacactttcttctattatcggtgttcag
caggtgcccgaagaagaaacacaccgctacggcattattgacccgctgacaagtgaaggc
cgccgttatcaggtgaaaaacttcgttgaaaaaccgcctaaaggcacagcaccttctaat
cttgccatcttaggccgttacgtattcacgcctgagatcttcatgtatttagaagagcag
caggttggcgccggcggagaaattcagctcacagacgccattcaaaagctgaatgaaatt
caaagagtgtttgcttacgattttgaaggcaagcgttatgatgttggtgaaaagctcggc
tttatcacaacaactcttgaatttgcgatgcaggataaagagcttcgcgatcagctcgtt
ccatttatggaaggtttactaaacaaagaagaaatctaa

DBGET integrated database retrieval system