KEGG   Bacillus subtilis BEST7613: BEST7613_6828Help
Entry
BEST7613_6828     CDS       T02410                                 

Gene name
murAA
Definition
UDP-N-acetylglucosamine1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bsub  Bacillus subtilis BEST7613
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bsub00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:bsub00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(7147931..7149241)
Genome map
AA seq 436 aa AA seqDB search
MEKIIVRGGQKLNGTVKVEGAKNAVLPVIAASLLASEEKSVICDVPTLSDVYTINEVLRH
LGADVHFENNEVTVNASYALQTEAPFEYVRKMRASVLVMGPLLARTGHARVALPGGCAIG
SRPIDQHLKGFEAMGAEIKVGNGFIEAEVKGRLQGAKIYLDFPSVGATENLIMAAALAEG
TTTLENVAKEPEIVDLANYINGMGGKIRGAGTGTIKIEGVEKLHGVKHHIIPDRIEAGTF
MVAAAITEGNVLVKGAVPEHLTSLIAKMEEMGVTIKDEGEGLRVIGPKELKPIDIKTMPH
PGFPTDMQSQMMALLLRASGTSMITETVFENRFMHAEEFRRMNGDIKIEGRSVIINGPVQ
LQGAEVAATDLRAGAALILAGLVAEGHTRVTELKHLDRGYVDFHQKLAALGADIERVNDE
SASEQENKEVVSDLNA
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaaaatcatcgtccgcggcggtcagaagttaaacggcacagtcaaagttgaaggc
gctaaaaatgccgttttacctgttatcgctgcatctttattagcaagtgaagaaaaaagc
gtaatttgtgatgtacctacgctctccgatgtatatacaattaacgaagtgttgcgtcat
ttaggagcagatgtgcattttgaaaataatgaagtgactgtaaatgcttcatacgctttg
caaactgaagcaccttttgaatatgttcgtaaaatgcgtgcgtctgtgcttgtcatgggg
ccgcttcttgcgcgtacaggtcatgcaagagttgcacttccgggcggatgcgcaattggt
tccagaccgattgatcagcatttaaaaggttttgaagcaatgggcgcagaaatcaaagtc
ggtaatggcttcattgaagctgaagtaaaaggccgactgcaaggcgcaaaaatttatctg
gacttcccaagtgtaggagctacagagaacctgattatggcagccgctctagctgaagga
acaacaacgctggaaaacgtggcaaaagaacccgaaatcgttgatttagcaaactatatc
aacggcatgggcggaaaaatccgcggagctggcaccggcaccatcaaaattgaaggagtc
gaaaagcttcacggcgtaaaacaccatattattcctgaccgtattgaagcgggcacattt
atggttgctgctgcaatcactgaaggaaacgtattagtaaaaggagcggttcctgagcac
ctcacctctttaattgcaaaaatggaagagatgggtgtaacaattaaggatgaaggtgaa
ggtctgcgtgtcatcggcccgaaagagcttaaaccgattgacatcaaaacaatgcctcac
ccgggcttcccgactgatatgcagtcacaaatgatggcgcttctgcttcgtgcaagcggc
acaagcatgattacagaaaccgtttttgaaaaccgttttatgcatgcggaagaattccgc
cgtatgaatggtgatatcaagattgaaggacgttctgtcatcattaacggtcctgtacag
cttcagggagctgaagttgcagcgactgatttgcgtgcaggtgcagcgctgattcttgcg
gggttagtggctgaaggtcacacacgtgttactgaattgaagcacttagaccgcggttac
gttgatttccatcagaagcttgccgctctgggcgcagacatcgaacgtgtaaatgatgag
tctgcttctgagcaagagaataaagaagtcgtttctgacttaaatgcataa

DBGET integrated database retrieval system