KEGG   Bacillus subtilis BEST7613: BEST7613_6862Help
Entry
BEST7613_6862     CDS       T02410                                 

Gene name
murAB
Definition
UDP-N-acetylglucosamine1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bsub  Bacillus subtilis BEST7613
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsub00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BEST7613_6862 (murAB)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BEST7613_6862 (murAB)
Enzymes [BR:bsub01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     BEST7613_6862 (murAB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(7176068..7177357)
Genome map
AA seq 429 aa AA seqDB search
MEKLNIAGGDSLNGTVHISGAKNSAVALIPATILANSEVTIEGLPEISDIETLRDLLKEI
GGNVHFENGEMVVDPTSMISMPLPNGKVKKLRASYYLMGAMLGRFKQAVIGLPGGCHLGP
RPIDQHIKGFEALGAEVTNEQGAIYLRAERLRGARIYLDVVSVGATINIMLAAVLAEGKT
IIENAAKEPEIIDVATLLTSMGAKIKGAGTNVIRIDGVKELHGCKHTIIPDRIEAGTFMI
AGAAMGKEVIIDNVIPTHLESLTAKLREMGYHIETSDDQLLIVGGQKNLKPVDVKTLVYP
GFPTDLQQPMTALLTRAKGTSVVTDTIYSARFKHIDELRRMGANMKVEGRSAIITGPVEL
QGAKVKASDLRAGACLVVAGLMADGVTEITGLEHIDRGYSSLEKKLEGLGATIWRERMTD
EEIEQLQNS
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagttgaatattgccggcggtgactcgttaaacggtacagtacatatcagcggc
gctaaaaacagcgctgttgcgttaatacctgcaaccattttggcaaattccgaggtgaca
attgaagggcttccagagatttcagatattgaaacgctgcgtgacctgttaaaggaaatc
ggcggcaacgtgcattttgagaatggggaaatggttgttgaccctacgtcgatgatcagc
atgccgcttcctaacgggaaagtaaaaaagcttcgcgcgtcatattatttaatgggggcg
atgctcggccgcttcaagcaggcggtcattggattgcctggcggctgtcacttagggccc
cgtccgattgatcagcatatcaaaggctttgaagcactcggagctgaagtaaccaatgaa
caaggcgccatttatttgcgagctgaaaggctgagaggcgcacggatttatttagatgtc
gtaagcgttggggcaacgattaacattatgctcgccgctgttttggcagaagggaaaacg
atcatcgaaaacgctgccaaggagcctgagatcattgacgtcgcgacattgcttaccagc
atgggcgccaaaatcaaaggtgcgggcaccaatgtgattcgaatcgacggcgtgaaggaa
ctgcacggctgcaagcatacgatcattccggacagaattgaagccgggacatttatgatt
gcaggggctgcaatgggcaaggaagtcattatcgataacgtcatccctactcatcttgag
tcgttaacggcaaagctgagagaaatgggctatcatatcgaaacaagcgacgaccagctc
ctcattgtcggcgggcagaagaacttaaagccggttgacgtcaaaaccctcgtatacccg
gggtttccgactgatttacagcagccgatgacggcgctcctgacaagggcgaaagggacg
agtgtcgtcacagacaccatctactcggcaagattcaagcacattgatgagctgagacga
atgggtgccaatatgaaagtagaaggcagatctgccatcatcacaggtcctgtcgagctt
caaggcgcaaaagtgaaggcgagtgatctgcgtgccggagcctgcttggtggtagccgga
ctgatggctgatggcgtcacggaaattacgggactggagcatattgaccgaggatacagc
agccttgagaagaagcttgaggggcttggagcgacaatttggcgtgaaagaatgactgac
gaagaaatagaacagcttcaaaattcataa

DBGET integrated database retrieval system