KEGG   Bacillus subtilis BEST7613: BEST7613_7177Help
Entry
BEST7613_7177     CDS       T02410                                 

Gene name
fbp
Definition
fructose-1,6-bisphosphatase
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
bsub  Bacillus subtilis BEST7613
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bsub00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BEST7613_7177 (fbp)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BEST7613_7177 (fbp)
   00030 Pentose phosphate pathway
    BEST7613_7177 (fbp)
   00051 Fructose and mannose metabolism
    BEST7613_7177 (fbp)
  Energy metabolism
   00680 Methane metabolism
    BEST7613_7177 (fbp)
Enzymes [BR:bsub01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     BEST7613_7177 (fbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7497982..7499907
Genome map
AA seq 641 aa AA seqDB search
MESKYLDLLAQKYDCEEKVVTEIINLKAILNLPKGTEHFVSDLHGEYQAFQHVLRNGSGR
VKEKIRDIFSGVIYDREIDELAALVYYPEDKLKLIKHDFDAKEALNEWYKETIHRMIKLV
SYCSSKYTRSKLRKALPAQFAYITEELLYKTEQAGNKEQYYSEIIDQIIELGQADKLITG
LAYSVQRLVVDHLHVVGDIYDRGPQPDRIMEELINYHSVDIQWGNHDVLWIGAYSGSKVC
LANIIRICARYDNLDIIEDVYGINLRPLLNLAEKYYDDNPAFRPKADENRPEDEIKQITK
IHQAIAMIQFKLESPIIKRRPNFNMEERLLLEKIDYDKNEITLNGKTYQLENTCFATINP
EQPDQLLEEEAEVIDKLLFSVQHSEKLGRHMNFMMKKGSLYLKYNGNLLIHGCIPVDENG
NMETMMIEDKPYAGRELLDVSERFLREAFAHPEETDDLATDMAWYLWTGEYSSLFGKRAM
TTFERYFIKEKETHKEKKNPYYYLREDEATCRNILAEFGLNPDHGHIINGHTPVKEIEGE
DPIKANGKMIVIDGGFSKAYQSTTGIAGYTLLYNSYGMQLVAHKHFNSKAEVLSTGTDVL
TVKRLVDKELERKKVKETNVGEELLQEVAILESLREYRYMK
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
ttggaaagcaagtacctagatctactcgcacaaaaatacgattgtgaagaaaaagtggta
acagaaatcatcaatttgaaagcgatattgaacctgccaaaaggcaccgagcattttgtc
agtgatctgcacggagagtatcaggcattccagcacgtgttgcgcaatggttcaggacga
gtcaaagagaagatacgcgacatcttcagcggtgtcatttacgatagagaaattgatgaa
ttagcagcattggtctattatccggaagacaaactgaaattaatcaaacatgactttgat
gcgaaagaagcgttaaacgagtggtataaagaaacgattcatcgaatgattaagctcgtt
tcatattgctcctctaagtatacccgctccaaattacgcaaagcactgcctgcccaattt
gcttatattacggaggagctgttatacaaaacagaacaagctggcaacaaggagcaatat
tactccgaaatcattgatcagatcattgaacttggccaagccgataagctgatcaccggc
cttgcttacagcgttcagcgattggtggtcgaccatctgcatgtggtcggcgatatttat
gaccgcggcccgcagccggatagaattatggaagaactgatcaactatcattctgtcgat
attcagtggggaaatcacgatgtcctttggatcggcgcctattccggttccaaagtgtgc
ctggccaatattatccgcatctgtgcccgctacgacaacctggatattattgaggacgtg
tacggcatcaacctgagaccgctgctgaacctggccgaaaaatattatgatgataatcca
gcgttccgtccaaaagcagacgaaaacaggccagaggatgagattaagcaaatcacaaaa
atccatcaagcgattgccatgatccaattcaagcttgagagcccgattatcaagagacgg
ccgaactttaatatggaagagcggctgttattagagaaaatagactatgacaaaaatgaa
atcacgctgaacggaaaaacatatcaactggaaaacacctgctttgcgacgattaatccg
gagcagccagatcagctattagaagaagaagcagaagtcatagacaagctgctattctct
gtccagcattccgaaaagctgggccgccatatgaattttatgatgaaaaaaggcagcctt
tatttaaaatataacggcaacctgttgattcacggctgtattccagttgatgaaaacggc
aatatggaaacgatgatgattgaggataaaccgtatgcgggccgtgagctgctcgatgta
tctgaacgattcttgcgggaagcctttgcccacccggaagaaaccgatgacctggcgaca
gatatggcttggtatttatggacaggcgaatactcctccctcttcggaaaacgcgccatg
acgacatttgagcgctatttcatcaaagagaaggaaacgcataaagagaagaaaaacccg
tattattatttacgagaagacgaggcaacctgccgaaacatcctggcagaattcggcctc
aatccagatcacggccatatcatcaacggccatacacctgtaaaagaaatcgaaggagaa
gacccaatcaaagcaaacggaaaaatgatcgtcatcgacggcggcttctccaaagcctac
caatccacaacaggcatcgccggctacacgctgctatacaactcctacggcatgcagctc
gtcgcccataaacacttcaattccaaggcagaagtcctaagcaccggaaccgacgtctta
acggtcaaacgattagtggacaaagagcttgagcggaagaaagtgaaggaaacgaatgtg
ggtgaggaattgttgcaggaagttgcgattttagagagtttgcgggagtatcggtatatg
aagtga

DBGET integrated database retrieval system