KEGG   Bacillus subtilis BEST7613: BEST7613_7184Help
Entry
BEST7613_7184     CDS       T02410                                 

Gene name
yycR
Definition
dehydrogenase
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
bsub  Bacillus subtilis BEST7613
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bsub01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:bsub00680]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:bsub00625]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(7505661..7506872)
Genome map
AA seq 403 aa AA seqDB search
MTGNKAVVYKGKGTVAVEDIGYPELILRDGPGVPKANVNRKCEHGVILKVITTNICGSDQ
HMVRGRTTAPEGLVLGHEITGEVIETGRDVEFIKKGDIVSVPFNIACGRCVMCKTQKTHV
CLNVNPDRPGSAYGYVDMGGWVGGQSEYVMVPYADFQLLVFPDKEQALEKILDLTMLSDI
FPTGFHGAYTAGVQTGSTVYIAGAGPVGLAAAHSAQLLGASTVIVGDLNEDRLAQARSFG
CETVNVQKHDRLGEQIEQILGEPTVDAAVDCVGFEASGHGNQGEAPAAVLNSIMDVTQVG
GSLGIPGLYVTEDPGAKDADAKTGSLKIRFGLGWAKAHTFVTGQTPAMTYNRNLMKAILS
GRAQIAKAVNATVISLDDAPKGYSDFDKGAAKKFVIDPHGTLK
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
ttgacaggaaacaaagcggttgtgtacaaaggcaaagggactgtagcggtggaggatatc
ggttatccggagttaatcttgagggacgggcccggcgtcccgaaggcgaatgtgaatcga
aaatgtgagcatggggttattctcaaagtcattacaaccaacatttgcggaagcgaccag
catatggtcagaggccgcacaacggcgccagaaggcttggtgctcgggcatgaaattacg
ggagaagtcattgaaacggggcgtgatgttgaatttatcaaaaaaggagatatcgtatcc
gttcctttcaatattgcctgcggacgctgtgtgatgtgcaaaacgcagaaaacgcatgtg
tgcctgaatgtcaatccggaccggccgggatcggcttacggctacgtcgatatgggcggc
tgggtcggcggccagtctgaatatgtcatggtgccatacgctgattttcagcttttggta
ttccctgataaagaacaggcgctagaaaagattctcgatttgaccatgctgtccgacatt
tttccgaccggcttccatggagcttatacagcgggcgtgcaaacaggttcaaccgtttat
atcgctggagcgggtcctgtcggcttggcagctgcacactccgctcagctcctaggcgcc
tctaccgtgattgtcggcgatctgaacgaagacaggctggcacaggccagaagcttcggc
tgtgaaacggtcaacgtgcaaaaacacgaccgcctcggcgagcaaattgaacaaatacta
ggtgaaccaaccgttgatgctgcagtggactgtgtcggctttgaagcatctgggcacggc
aatcaaggagaagcgccagccgccgtgctgaactcaatcatggacgtcacccaggtcgga
ggcagccttggcattccaggcttatacgtgaccgaagatcccggtgcaaaggatgcggac
gccaaaacaggctcattaaaaatccgcttcggactcggctgggccaaagcccacaccttc
gtcaccggacaaacgcccgccatgacatacaaccgcaatttgatgaaagcgatcctgagc
ggcagagcgcagatcgcaaaagccgtcaatgccaccgttatttctctggacgacgcgcca
aaaggctacagcgacttcgacaaaggcgcagccaaaaaattcgtcatcgacccgcatggg
acattgaagtaa

DBGET integrated database retrieval system