KEGG   Bacillus subtilis BEST7613: BEST7613_7184Help
Entry
BEST7613_7184     CDS       T02410                                 

Gene name
yycR
Definition
dehydrogenase
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
bsub  Bacillus subtilis BEST7613
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bsub00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BEST7613_7184 (yycR)
  Energy metabolism
   00680 Methane metabolism
    BEST7613_7184 (yycR)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BEST7613_7184 (yycR)
Enzymes [BR:bsub01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     BEST7613_7184 (yycR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(7505661..7506872)
Genome map
AA seq 403 aa AA seqDB search
MTGNKAVVYKGKGTVAVEDIGYPELILRDGPGVPKANVNRKCEHGVILKVITTNICGSDQ
HMVRGRTTAPEGLVLGHEITGEVIETGRDVEFIKKGDIVSVPFNIACGRCVMCKTQKTHV
CLNVNPDRPGSAYGYVDMGGWVGGQSEYVMVPYADFQLLVFPDKEQALEKILDLTMLSDI
FPTGFHGAYTAGVQTGSTVYIAGAGPVGLAAAHSAQLLGASTVIVGDLNEDRLAQARSFG
CETVNVQKHDRLGEQIEQILGEPTVDAAVDCVGFEASGHGNQGEAPAAVLNSIMDVTQVG
GSLGIPGLYVTEDPGAKDADAKTGSLKIRFGLGWAKAHTFVTGQTPAMTYNRNLMKAILS
GRAQIAKAVNATVISLDDAPKGYSDFDKGAAKKFVIDPHGTLK
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
ttgacaggaaacaaagcggttgtgtacaaaggcaaagggactgtagcggtggaggatatc
ggttatccggagttaatcttgagggacgggcccggcgtcccgaaggcgaatgtgaatcga
aaatgtgagcatggggttattctcaaagtcattacaaccaacatttgcggaagcgaccag
catatggtcagaggccgcacaacggcgccagaaggcttggtgctcgggcatgaaattacg
ggagaagtcattgaaacggggcgtgatgttgaatttatcaaaaaaggagatatcgtatcc
gttcctttcaatattgcctgcggacgctgtgtgatgtgcaaaacgcagaaaacgcatgtg
tgcctgaatgtcaatccggaccggccgggatcggcttacggctacgtcgatatgggcggc
tgggtcggcggccagtctgaatatgtcatggtgccatacgctgattttcagcttttggta
ttccctgataaagaacaggcgctagaaaagattctcgatttgaccatgctgtccgacatt
tttccgaccggcttccatggagcttatacagcgggcgtgcaaacaggttcaaccgtttat
atcgctggagcgggtcctgtcggcttggcagctgcacactccgctcagctcctaggcgcc
tctaccgtgattgtcggcgatctgaacgaagacaggctggcacaggccagaagcttcggc
tgtgaaacggtcaacgtgcaaaaacacgaccgcctcggcgagcaaattgaacaaatacta
ggtgaaccaaccgttgatgctgcagtggactgtgtcggctttgaagcatctgggcacggc
aatcaaggagaagcgccagccgccgtgctgaactcaatcatggacgtcacccaggtcgga
ggcagccttggcattccaggcttatacgtgaccgaagatcccggtgcaaaggatgcggac
gccaaaacaggctcattaaaaatccgcttcggactcggctgggccaaagcccacaccttc
gtcaccggacaaacgcccgccatgacatacaaccgcaatttgatgaaagcgatcctgagc
ggcagagcgcagatcgcaaaagccgtcaatgccaccgttatttctctggacgacgcgcca
aaaggctacagcgacttcgacaaaggcgcagccaaaaaattcgtcatcgacccgcatggg
acattgaagtaa

DBGET integrated database retrieval system