KEGG   Brucella suis bv. 2 Bs364CITA: BSSP2_II0746Help
Entry
BSSP2_II0746      CDS       T03741                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase, Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bsuc  Brucella suis bv. 2 Bs364CITA
Pathway
bsuc00071  Fatty acid degradation
bsuc00072  Synthesis and degradation of ketone bodies
bsuc00280  Valine, leucine and isoleucine degradation
bsuc00310  Lysine degradation
bsuc00362  Benzoate degradation
bsuc00380  Tryptophan metabolism
bsuc00620  Pyruvate metabolism
bsuc00630  Glyoxylate and dicarboxylate metabolism
bsuc00640  Propanoate metabolism
bsuc00650  Butanoate metabolism
bsuc00900  Terpenoid backbone biosynthesis
bsuc01100  Metabolic pathways
bsuc01110  Biosynthesis of secondary metabolites
bsuc01120  Microbial metabolism in diverse environments
bsuc01130  Biosynthesis of antibiotics
bsuc01200  Carbon metabolism
bsuc01212  Fatty acid metabolism
bsuc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsuc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSSP2_II0746
   00630 Glyoxylate and dicarboxylate metabolism
    BSSP2_II0746
   00640 Propanoate metabolism
    BSSP2_II0746
   00650 Butanoate metabolism
    BSSP2_II0746
  Lipid metabolism
   00071 Fatty acid degradation
    BSSP2_II0746
   00072 Synthesis and degradation of ketone bodies
    BSSP2_II0746
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BSSP2_II0746
   00310 Lysine degradation
    BSSP2_II0746
   00380 Tryptophan metabolism
    BSSP2_II0746
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BSSP2_II0746
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BSSP2_II0746
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BSSP2_II0746
Enzymes [BR:bsuc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BSSP2_II0746
Exosome [BR:bsuc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BSSP2_II0746
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AIB32936
Position
II:complement(736642..737850)
Genome map
AA seq 402 aa AA seqDB search
MAEAYIYDHVRTPRGRGKKDGSLHEVPAVRLGAKVLESLRDRNGIDTAKVDDIIFGCVDP
VGEAGAVIPRSAAFEAGYDFKAPGIQISRFCASGLDAINLAAAKVAFGSDDLVIAGGVES
MSRVGMGMSGGAWYMDPSVGFPGYFMPQGVSADLIATKYGFSRDDVDAYAVESQKRAANS
WEKGYFKNSVITIKDQNGLTILDRDEHMRPGTDMQALGQLNPSFVMPGEMGGFNAVGIQA
HPEIETVNHVHHAGNSSGIVDGAAGVLVGSRKAGKAFDIKPRARIRAFANIGSEPALMLT
GPVDVTEKLLKQAKMKISDIDLFELNEAFAAVVLRYMQAFDIPHDKINVNGGAIAMGHPL
GATGAMILGTVLDELERRNLNTALVTLCIGAGMGTATIIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggcttatatttacgatcacgtgcgcacgccgcgcgggcgcggcaagaaggac
ggctccctgcacgaagtgcctgccgttcgtctgggcgcgaaggttctggaatccctgcgc
gaccgcaacggcatcgacaccgccaaggtcgatgacattattttcggctgcgtcgatccg
gtcggcgaagcaggcgcggtcattccgcgttcggcggctttcgaggccggttatgatttc
aaggcgccgggcatccagatttcgcgcttctgcgcttcgggccttgatgccatcaatctg
gccgctgccaaggtggcattcggttcggatgatctggtgattgcgggcggcgtggaaagc
atgtcgcgcgtcggcatgggcatgtcgggcggcgcctggtacatggacccatcggttggc
ttccccggctatttcatgccgcagggcgtttccgccgacctgattgccaccaaatacggt
ttcagccgcgatgatgtcgatgcctatgctgtcgaaagccagaagcgcgctgccaattcg
tgggaaaagggctatttcaagaattcggtcatcacgatcaaggaccagaacggcctcacc
attctcgaccgtgacgagcatatgcgccccggcaccgacatgcaggcgctgggccagttg
aacccgtccttcgtgatgccgggcgaaatgggtggcttcaatgctgtcggcattcaggcg
cacccggaaatcgaaaccgtcaaccatgtccaccatgccggcaattcgtcgggcatcgtg
gatggcgcggcgggggttctcgtcggctccaggaaggctggcaaggccttcgatatcaag
ccgcgcgcgcgcattcgtgcttttgccaatatcggttcggaaccggcgcttatgctgacc
ggcccggtcgatgtgacggaaaagctgctgaaacaggccaagatgaagatttcggacatt
gatctgttcgagttgaacgaagccttcgccgcggtggtcctgcgctatatgcaggctttc
gatattccgcacgacaagatcaacgtcaatggcggcgccattgccatgggccatccgctc
ggtgccaccggcgcgatgatcctcggcacggtgctggatgaactggaacgccgcaatctc
aataccgctctggtgacgctgtgcatcggtgccggtatgggcacggccacgatcatcgag
cgcgtgtaa

DBGET integrated database retrieval system