KEGG   Brucella suis VBI22: BSVBI22_A0203Help
Entry
BSVBI22_A0203     CDS       T01706                                 

Definition
zinc-containing alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bsv  Brucella suis VBI22
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bsv00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BSVBI22_A0203
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSVBI22_A0203
  Lipid metabolism
   00071 Fatty acid degradation
    BSVBI22_A0203
  Amino acid metabolism
   00350 Tyrosine metabolism
    BSVBI22_A0203
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BSVBI22_A0203
   00626 Naphthalene degradation
    BSVBI22_A0203
Enzymes [BR:bsv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BSVBI22_A0203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
I:215555..216589
Genome map
AA seq 344 aa AA seqDB search
MAKTMKAAVVRAFGKPLTIDEVPIPQPGPGQIQVAIQASGVCHTDLHAAEGDWPVKPNPP
FIPGHEGVGFVSAVGSGVKHVKEGDRVGIPWLYTACGHCRHCLGGWETLCEEQLNTGYSV
NGGFAEYVVADPNFVGHLPKNIDFNEIAPVLCAGVTVYKGLKVTDTKPGDWVVISGIGGL
GHMAVQYARAMGLNVAAVDIDDRKLDLARRLGATVTVNAKTVADPAAYIRKETDGGAQGV
LVTAVSPKAFEQALGMVARGGTVSLNGLPPGDFPLSIFNMVLNGVTVRGSIVGTRLDLQE
SLDFAADGKVKATIQTGKLEDINAIFDDMRQGNIEGRIVMDLTQ
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagacgatgaaagctgcggtcgtgcgtgccttcggcaaaccgctgacgattgat
gaagtgccgatacctcaacccggtcccggccagattcaggttgccattcaggcttccggc
gtatgccataccgaccttcatgccgccgagggcgattggccggtaaaacccaatccgccc
ttcattccgggtcatgagggtgtcggtttcgtttccgccgtgggcagcggcgtcaagcat
gtcaaggaaggcgaccgtgtcggcattccatggctttacactgcctgcggccattgccgc
cattgccttggtggctgggaaacgctttgcgaggaacagctcaataccggctattccgtc
aatggcggctttgccgaatatgtggtggccgatccgaatttcgtcggccacttgccgaag
aatatcgatttcaacgagattgcgccggtgctctgcgcgggcgtgacggtctataagggc
ctcaaggtcacggatacgaagcccggtgactgggtggtcatttcaggcataggcgggctc
ggccacatggctgtgcaatatgccagggccatggggctgaatgttgccgccgtcgatatt
gacgaccgcaagctcgatctcgcccgcagacttggcgcaaccgttacggtcaacgctaag
acggttgccgacccggcagcctatattcgcaaggaaaccgatggcggtgcgcaaggcgtg
ctggtgacggcggtttcgcccaaggcttttgaacaggcgctgggcatggttgcgcgcggc
ggtactgtttcgctgaatggcctgccgcctggcgatttcccgctttccatcttcaacatg
gtgctcaatggcgtaacggtgcgcggctccatcgtggggacgcggcttgatttgcaggaa
tcgctcgattttgcagccgacggcaaggtcaaggccaccatccaaaccggcaagctggaa
gacatcaacgccatcttcgacgatatgcggcaaggcaatatcgaaggccgcatcgtgatg
gacctgactcaatag

DBGET integrated database retrieval system