KEGG   Brucella suis VBI22: BSVBI22_A0253Help
Entry
BSVBI22_A0253     CDS       T01706                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
bsv  Brucella suis VBI22
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bsv01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:bsv00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
I:complement(261305..262597)
Genome map
AA seq 430 aa AA seqDB search
MVTTLRQTDPDFEQKFAAFLSGKREVSEDVDRAVREIVDRVRREGDSALLDYSRRFDRID
LEKTGIAVTEAEIDAAFDAAPASTVEALKLARDRIEKHHARQLPKDDRYTDALGVELGSR
WTAIEAVGLYVPGGTASYPSSVLMNAMPAKVAGVDRIVMVVPAPDGNLNPLVLVAARLAG
VSEIYRVGGAQAIAALAYGTETIRPVAKIVGPGNAYVAAAKRIVFGTVGIDMIAGPSEVL
IVADKDNNPDWIAADLLAQAEHDTAAQSILMTNDEAFAHAVEEAVERQLHTLARTETASA
SWRDFGAVILVKDFEDAIPLANRIAAEHLEIAVADAEAFVPRIRNAGSIFIGGYTPEVIG
DYVGGCNHVLPTARSARFSSGLSVLDYMKRTSLLKLGSEQLRALGPAAIEIARAEGLDAH
AQSVAIRLNL
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggtcacaacgctcagacagaccgaccctgattttgaacagaagtttgcggccttcctc
tccggcaagcgcgaggtttcggaagatgtggaccgcgccgtgcgggaaatcgtggatcgt
gtacgccgcgagggtgacagcgcgctgctcgattattcacgccgcttcgaccggatcgat
ctggaaaagaccggcattgccgtcaccgaggccgagatcgatgccgcattcgatgccgct
cccgcctccaccgtcgaagcattgaagcttgcgcgcgaccgtatcgaaaagcaccatgct
cgccagttgccgaaggacgaccgctatacggatgcgcttggcgtcgagcttggctcgcgc
tggacggccatcgaggctgtcggcctctatgtgcctggcggcacggccagctatccaagt
tccgttctgatgaatgcgatgcccgccaaggtcgcaggcgtggaccgcatcgtcatggtg
gtgcccgcacccgatggcaatctcaatccgctggtgctggtggcagcccgccttgcaggc
gtgtcggagatttaccgcgtcggcggcgcgcaggccattgccgcccttgcctatggcacc
gaaacgatccgtcccgtcgccaagatcgtcggccccggcaatgcctatgtggcagcggca
aagcgcatcgtattcggaacggtcggcatcgacatgatcgccgggccatccgaagtgctg
atcgtggccgacaaggacaataacccggactggatcgccgccgatcttctggcacaggcc
gagcacgatacggccgcgcaatccatcctgatgaccaatgacgaggcctttgcccacgcg
gtggaagaagcggtcgaacggcagcttcacaccctggcgcgcactgaaacggcttccgca
agctggcgcgatttcggtgcggtcattctggtcaaggatttcgaggacgcaattccgctt
gccaaccgtattgcggccgagcatctggaaatcgccgtggccgatgcggaggcgttcgta
ccgcgcatccgcaatgccggttccatattcattggcggttatacaccggaagtgatcggc
gattatgtggggggctgcaaccatgtgctgccaacggcgcgctctgcccgtttctcctcc
ggcctttcggtgctcgattatatgaagcgcacctcgcttctcaagctgggctccgagcag
cttcgcgcacttggaccggctgcgatcgagattgcacgcgccgagggtctcgatgcccat
gcccaatccgtcgccattcgtctgaacctatga

DBGET integrated database retrieval system