KEGG   Brucella suis VBI22: BSVBI22_A0255Help
Entry
BSVBI22_A0255     CDS       T01706                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bsv  Brucella suis VBI22
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsv00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BSVBI22_A0255 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BSVBI22_A0255 (murA)
Enzymes [BR:bsv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     BSVBI22_A0255 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(263383..264672)
Genome map
AA seq 429 aa AA seqDB search
MDRIKIVGGNKLNGVIPISGAKNAALPLMIASLLTDDTLTLENVPHLADVEQLIRILSNH
GVDYSVNGRREHQNGPYSRTIHFTARNIVDTTAPYELVSRMRASFWVIGPLLARMGEANV
SLPGGCAIGTRPVDLLLDALLALGAEIDIENGYAKAKARNGLVGARYKFPKVSVGATHVM
LMAATLAKGETIIENAAREPEVANLADCLNAMGAKISGAGSSTIHVQGVTNLSGARVRII
PDRIEAGTYAMAVAMTGGDVLLEGAQESQLSCVLETLRQAGAEINETNSGLRVVRNGHGI
QPVDITTDPFPGFPTDLQAQFMGLMTRAKGTSHITETIFENRFMHVQELARLGAKISLSG
QTATVEGVERLKGAQVMATDLRASVSLVIAGLAAEGETIVNRVYHLDRGFERLEEKLSRC
GADVKRISG
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggatcgcattaaaatcgtcggcggcaacaagctcaacggcgtcattcccatttccggc
gctaaaaacgctgcccttcccctgatgatcgcctcgcttctcaccgacgatacgctcacg
ctggaaaacgtgccccatctggccgatgtcgagcaattgatccgcatcctgagcaatcat
ggcgtcgattattccgtgaacggacgtcgcgaacaccagaacggcccctattcccgcacg
atccatttcaccgcccgcaatatcgtggacacgaccgcgccttatgagctcgtttccagg
atgcgcgccagcttctgggttatcggtccgcttctcgcccgcatgggtgaggccaatgtt
tcgctgcccggcggctgcgccatcggcacacgtcccgtggacctgctgcttgatgccctg
ctggcgctcggcgcggaaatcgacattgaaaacggttatgccaaagccaaggccaggaac
ggccttgtcggcgcgcgctataaattccccaaggtttcggtcggcgccacgcatgtcatg
ctgatggcggcaacgctggccaagggcgaaaccatcattgaaaatgccgcacgcgaaccg
gaagtggcaaacctcgccgactgtctcaacgccatgggggcgaagatcagcggcgcgggc
agcagcacgatccatgttcaaggcgtcaccaatctttccggcgcgcgcgtgcgcatcatc
ccggaccgtatcgaggcgggcacctatgccatggccgtggcaatgaccggcggcgatgtt
cttctggaaggtgcgcaggaaagccagctttcctgtgtgcttgaaacgctgcgccaggca
ggcgctgaaatcaacgagaccaatagcggcctgcgcgtggtgcgcaacgggcacggcatc
cagccggtcgatatcaccaccgatcccttccccggcttcccgaccgatcttcaggcgcag
ttcatgggcctgatgacccgcgccaaaggcacctcgcacattaccgagaccatctttgaa
aaccgcttcatgcatgtgcaggaactggcgcgtctgggggcgaaaatctcgctctccggc
cagaccgcaaccgtggagggcgtggaacgcctgaagggcgcgcaggtgatggcgacggac
ctgcgtgcctctgtttcgctggtgatcgcaggacttgcagccgaaggcgaaaccatcgtc
aaccgcgtctatcaccttgatcgcggctttgaacggctggaggaaaagctttcgcgctgc
ggcgcggatgtcaagcgtatcagcggctga

  All links  
No link information was found.   
DBGET integrated database retrieval system