KEGG   Brucella suis VBI22: BSVBI22_A0543Help
Entry
BSVBI22_A0543     CDS       T01706                                 

Gene name
xylA
Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
bsv  Brucella suis VBI22
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsv00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BSVBI22_A0543 (xylA)
   00051 Fructose and mannose metabolism
    BSVBI22_A0543 (xylA)
Enzymes [BR:bsv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     BSVBI22_A0543 (xylA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(541438..542745)
Genome map
AA seq 435 aa AA seqDB search
MSTGFFGDIQKVRYEGPESDNPLAFRHYNADEIVLGKRMEDHLRFAVAYWHSFAWEGGDP
FGGRTFDRPWFSNEIDAAKLKADVAFEFFSLLGAPYYCFHDADVRPEGRNFAENTRYLNE
IVDIFEKKQAETGMKLLWGTANLFSNRRYMAGAATNPDPDVFAFAAATVKTCIDATKRLG
GENYVLWGGREGYETLLNTDLSRELDHMGRFLSLVVEYKHKIGFKGTILIEPKPQEPTKH
QYDYDVATVYGFLKRYGLENEVKVNIEQGHAILAGHSFEHELALARTLGIFGSIDMNRND
YQSGWDTDQFPNNVPEMALAYYQVLLAGGFTTGGTNFDAKLRRQSLDSQDLLIGHIGGMD
CCARGLKAAARMLEDGALSKPLDERYAGWNGEFGKRLLSGLSLDQIAGEVEAKDINPQPK
SGRQEYLENIVNHYV
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgagtacgggatttttcggcgatattcagaaggtgcgctatgaggggccggagagcgac
aatccgctggccttccgccattataatgcagatgaaatcgtgctcggcaaacgcatggaa
gaccatttgcgctttgcggtggcctattggcacagtttcgcctgggagggtggcgatccg
ttcggcgggcgcaccttcgaccggccgtggttttccaacgagatcgatgcggcaaaactc
aaggccgatgtcgcctttgaattcttctccctgctcggcgcaccttattactgcttccac
gatgccgatgtgcggccagagggccgcaattttgcggaaaacacgcgctatctcaatgaa
attgtcgatattttcgagaagaagcaggccgaaaccggcatgaaactgctctggggcacg
gccaatcttttttccaaccggcgctatatggcgggtgcggccacaaatcccgatcctgat
gtcttcgcttttgccgctgcaacagtgaagacctgtatcgacgccaccaagcggctcggt
ggagagaattacgtgctttggggcggtcgcgaaggctatgaaaccctgctcaataccgat
ctttcgcgtgaactcgaccatatgggccggttccttagcctcgtggtggaatacaagcac
aaaatcggcttcaagggcacgatcctgatcgagcccaagccgcaggagccgaccaaacat
cagtatgattacgatgtcgcgacggtttacggcttcctcaagcgttacggtctggaaaac
gaggtgaaggtcaatatcgagcagggccatgccattctggccggtcactcgttcgagcat
gagctggcgcttgcccgcacacttggcattttcggctccatcgacatgaaccgcaacgat
taccaatccggctgggacaccgatcagttcccgaacaatgtgccggagatggcgctggcc
tattatcaggttctgctggcaggcggcttcacgaccggcggcacgaatttcgacgccaag
ctgcgccgccagtcgcttgattcgcaggatctgctaatcggccatattggcggcatggat
tgctgtgcacgcggactaaaagcagccgcgcggatgcttgaagacggcgctttatccaag
ccgcttgatgagcgttatgcgggctggaacggcgagttcggcaagaggcttctgagcggc
ctttcgctggaccagatcgcgggtgaagtcgaagcgaaagacatcaatccgcagccgaaa
tccggccgtcaggaatatctggaaaacatcgtcaatcactacgtttga

DBGET integrated database retrieval system