KEGG   Brucella suis VBI22: BSVBI22_A0753Help
Entry
BSVBI22_A0753     CDS       T01706                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
bsv  Brucella suis VBI22
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BSVBI22_A0753 (hemB)
Enzymes [BR:bsv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     BSVBI22_A0753 (hemB)
Exosome [BR:bsv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BSVBI22_A0753 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(745187..746224)
Genome map
AA seq 345 aa AA seqDB search
MTDRQSKYLPANISQHVDDVTGSRRLRRMRKADWSRRLVQENHLTVNDLILSFFLTYGSG
VTEPVEAMPGVERYSVDMAVRMAEKAARLGIPAIAPFPREKPEVKTDDGSFVANPDNLIN
RAVRAIKKEVPEIGIITDAALDPFTTHGHDGILRDGEILNDESVAMVVRGALSQAEAGAD
IIAPSDMMDGRVGAVRQALDEHGFSHVPIMSYATKFASAFYGPYRGAIGTQGLLKGDKKT
YYIDPANPEEAVREAEQDIAEGADMLMVKPGLPYLDIIHRLKDEFRLPTFAYQVSGEYAM
IKAAGINGWIDEEKVMMESLLAFKRAGCDGILTYFAMEVAEKLKA
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcgtcagtccaaatatctgccagccaatatcagccagcacgtcgatgacgta
acgggcagccgccgcctgcgccgcatgcgcaaggccgactggtcgcgcaggctggtgcag
gaaaaccacctgacggtgaacgacctcattctttccttcttcctgacctatggctccggc
gtgaccgagccggtggaagcaatgcccggcgtggaacgttattcggtggatatggccgtg
cgcatggctgaaaaagccgccaggcttggcattccagccatcgcccccttcccgcgcgaa
aagccggaagtgaaaaccgacgacggctccttcgtcgcaaacccggataacctcatcaac
cgtgcggtacgcgccatcaagaaagaagtgccggaaatcggcatcatcaccgatgccgcg
ctggaccccttcaccacacatggccatgacggcattttgcgcgacggagaaattctcaac
gacgaatcggtcgccatggtggtgcgcggcgcgctttcccaggccgaggccggtgcagac
atcatcgccccgtccgacatgatggatggccgtgtgggcgctgtccgccaggcactggac
gagcacggcttcagccatgtgccgatcatgtcctatgcgaccaagttcgcctctgccttt
tacggcccctatcgcggcgccatcggcacgcaaggcctgctgaaaggcgacaagaaaacc
tattacatcgatccggccaaccctgaagaagctgttcgcgaagccgaacaggacattgcc
gagggcgccgacatgctgatggtgaaaccgggcctgccctatctcgatatcatccaccgt
ctgaaggacgaattccgcctgccgaccttcgcctatcaggtatccggcgaatatgcgatg
ataaaggctgccgggatcaatggctggatcgacgaggaaaaggtgatgatggaaagcctg
ctcgccttcaagcgcgcaggctgtgacggaattctgacctatttcgcaatggaagtggct
gaaaagctcaaggcctga

DBGET integrated database retrieval system