KEGG   Brucella suis VBI22: BSVBI22_A0875Help
Entry
BSVBI22_A0875     CDS       T01706                                 

Definition
Beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bsv  Brucella suis VBI22
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsv00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BSVBI22_A0875
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    BSVBI22_A0875
Enzymes [BR:bsv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BSVBI22_A0875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:853021..854040
Genome map
AA seq 339 aa AA seqDB search
MKECKAWIAGISGTKLTPDEIAFFRDETPWGFILFARNVESLEQVSELTAHLRDLTGLDQ
TPVFIDQEGGRVQRLRPPLVPNYPSASEIGAIYARDKEKGLRAAWLHARLHAFDLLKVGV
NADCLPVLDVPVEGAHDVIGMRAYSKNPHAVAEMGRAAAEGLLAGGVLPVVKHMPGHGRA
FSDTHKELARVSVALNELVAHDFVPFKALNDLPMAMTAHVVFDCIDPERPSTLSPTVINT
IIRDVIGFDGLVISDDISMKALSGDLGDITDGIVTAGCDIVLYCSGVMEELVKVAARVPV
LDGKAKRRAELAEVYAGDPDLSDEDEVRAEFNAMFEPIA
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagtgcaaggcatggattgccggtatatccggcacgaagctcaccccggacgag
attgccttcttccgggatgaaaccccgtggggcttcattctttttgctcgcaatgtggaa
agcctcgaacaggtgagcgagctcaccgcccatctgcgtgacctgacggggctggaccag
acgccggttttcatcgatcaggagggcgggcgcgtgcagcgccttcgcccgccgctggta
ccgaactatccgtccgcgtccgaaattggcgcgatctatgcacgcgacaaggaaaagggg
ttgcgtgccgcctggctccatgcccggctccatgctttcgatctgttgaaggtcggcgtc
aatgcggattgcctgccggttctggatgtgccggtggagggcgcgcatgatgtgatcgga
atgcgggcctattccaaaaacccccatgcggttgcggaaatgggacgcgctgccgccgaa
ggtcttctggctggcggcgttcttcccgtcgtgaagcatatgccgggccatggccgcgcc
ttttccgatacgcataaggaactggcgcgggtcagcgttgcgctcaacgaactggttgcg
catgatttcgtgccgttcaaggcgctcaatgatctgccgatggccatgaccgcccatgtg
gtgttcgattgcatcgacccggaaagaccgtccacgctttcgccgacggttattaatacg
atcattcgcgatgtgatcgggttcgacggccttgtcatcagtgacgacatttccatgaag
gcattgtccggcgatcttggcgatataaccgacggcatcgttacggcgggctgcgatatc
gtgctctattgctcaggcgttatggaggaactggtaaaggttgccgcccgtgtgccggtt
ctggatggcaaagcaaagcgccgggccgaactggcggaagtctatgcgggcgaccccgat
ctttccgacgaggacgaggtgcgcgccgaattcaatgccatgtttgaaccgatagcgtaa

DBGET integrated database retrieval system