KEGG   Brucella suis VBI22: BSVBI22_A0883Help
Entry
BSVBI22_A0883     CDS       T01706                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bsv  Brucella suis VBI22
Brite
Enzymes [BR:bsv01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     BSVBI22_A0883 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:859901..860500
Genome map
AA seq 199 aa AA seqDB search
MRGHSIDDPQLFAAIEATPRQSFLAAAWSHLAYSPRTAPLDCGEYMEGIDDQARVISALK
LEPGHRVLEIGTGSGFTAAVMSLLSGRVTTVERYRKLCDHALQQFVSLKRENIMVKHTDG
RHGMPGGPFDRIVIWLACDEVPRHFVELLATHGVLIAPIGPGDGRQIMTRISKVGSRFEQ
EDLMPVRYQPFIEGTSSVL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgggcacagcattgatgatccgcaactttttgcggcaattgaagcaacgccgcgc
cagagctttctggcggcggcatggtcgcatcttgcctatagcccgcgaaccgcgccgctt
gattgcggtgaatatatggaaggcatagacgatcaggcgcgcgtcatttccgccctgaag
cttgagcccggccatcgggttctggaaatcggcaccggctccggctttaccgccgccgtt
atgtccttgctgtccggccgtgtaacgacggtggaacggtatcgaaaactctgcgaccac
gctctccagcagttcgtttcgctgaagcgcgagaatatcatggtgaaacatacagacggg
cgccacggtatgccgggcgggccgtttgaccgcattgtcatctggctcgcatgcgatgag
gtgccgcgccatttcgttgaactgctcgccacccatggcgtcctgatagccccgatcggc
cctggcgatggacgccagatcatgacgcggatttcaaaggttggaagccgttttgaacag
gaagacctcatgccggttcgatatcagccgttcatcgaaggcacgtcttccgttctttag

DBGET integrated database retrieval system