KEGG   Brucella suis VBI22: BSVBI22_A0940Help
Entry
BSVBI22_A0940     CDS       T01706                                 

Definition
protein-L-isoaspartate O-methyltransferase, putative
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bsv  Brucella suis VBI22
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:915313..915981
Genome map
AA seq 222 aa AA seqDB search
MVADFQDLRTKMVDNQIRTTDVTDLAVIDAFLTVPREAFVPASRQALAYIDEDQLLESEG
PAPRYIMEPSPFAKLVQLARVSKSDVVLDIGCASGYSAAVLSQLAGSVIGLESDSSLAAA
ATARLQEFGYDNVVIVSGELRAGYPSEAPYDVIFIEGAVDFVPDVLFNQLKEGGRLVAVE
GRGNAGVARLYVKESGVASGRTVFNAAIKPLPGFECEEQFEF
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggtagccgatttccaggatcttcgcacaaagatggtcgataaccagatccgcacgacg
gacgtgactgatctggcggttatcgatgcgtttctgaccgttccgcgcgaggcattcgtt
ccggcaagccgtcaggctctggcctatatcgatgaagatcagcttctggaaagcgaaggc
ccggccccgcgttatatcatggagccttcgcccttcgccaagcttgtgcagcttgcccgt
gtcagcaagagcgatgtcgttctcgatatcggctgcgcatccggctattcggcggctgtc
ctttcccaattggctggatcggtcatcggtttggaaagcgattcctcgcttgcagccgcc
gcaacggcgcgtcttcaggaattcggttatgacaacgttgtgatcgtttcgggcgagttg
agggcaggctatccgtccgaagcaccctatgatgttattttcatcgaaggtgcagttgat
ttcgtcccggacgttctgttcaatcagctcaaggaaggcggtcgcctggttgcggtcgaa
ggccgtggaaatgcgggcgttgcgcgtctttacgtcaaggaaagcggcgtggcttccggg
cgtaccgttttcaatgcagcgatcaaaccgctccccggtttcgagtgtgaagagcagttc
gaattttaa

DBGET integrated database retrieval system