KEGG   Brucella suis VBI22: BSVBI22_A1458Help
Entry
BSVBI22_A1458     CDS       T01706                                 

Gene name
pncA
Definition
(GenBank) pyrazinamidase/nicotinamidase
  KO
K08281  nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
bsv  Brucella suis VBI22
Pathway
bsv00760  Nicotinate and nicotinamide metabolism
bsv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BSVBI22_A1458 (pncA)
Enzymes [BR:bsv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     BSVBI22_A1458 (pncA)
    3.5.1.-  
     BSVBI22_A1458 (pncA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Isochorismatase MR_MLE_C
Motif
Other DBs
NCBI-ProteinID: AEU06459
Position
I:1421591..1422220
Genome map
AA seq 209 aa AA seqDB search
MIGHALVVIDVQNDFCPGGALAIERGDEIIPIVNRLIGESENVVVTQDWHPANHSSFASN
HPGSRPFDTVNMSYGPQVLWPDHCVQNSEGAEFHPDLQWWRAQLVVRKGVRIGIDSYSAF
FENDHCTPTGLGGYLRERNIGSLTMVGLATDFCVASSALDAVQQGFQVRVRLDACRGIDL
NGSMNIMLEKMKQAGVELIDEPVSASHLL
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgatcggccatgcacttgtggttatcgacgtccagaatgatttttgccccggcggcgcc
ttggccatcgaacgtggcgatgaaatcatcccgatcgtcaaccgcctgatcggggaaagc
gaaaatgtcgtggtcacgcaggattggcatccggccaaccattccagcttcgcctccaac
caccccggcagccgcccgttcgatacggtcaatatgtcttatgggccgcaggtgctctgg
ccggatcattgcgtgcaaaatagcgagggggcagaatttcaccccgatctgcaatggtgg
cgtgcacagcttgtcgtccgcaagggtgtccgcattggtatcgacagctactccgcattt
tttgaaaatgaccattgcacgccgacgggccttggcggatatttgcgtgaacgcaatatc
ggatcattgacaatggttggcctcgccaccgatttctgcgtcgccagttcagcgcttgat
gcggtccagcagggctttcaggtgcgggtgcgactcgatgcctgccgcggtattgatctc
aacgggtcgatgaacatcatgctggagaaaatgaaacaggctggcgtcgaactgatcgat
gagcctgtttcagcgtcgcatctactctag

DBGET integrated database retrieval system