KEGG   Brucella suis VBI22: BSVBI22_A1807Help
Entry
BSVBI22_A1807     CDS       T01706                                 

Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bsv  Brucella suis VBI22
Pathway
bsv00010  Glycolysis / Gluconeogenesis
bsv00620  Pyruvate metabolism
bsv00640  Propanoate metabolism
bsv00680  Methane metabolism
bsv01100  Metabolic pathways
bsv01110  Biosynthesis of secondary metabolites
bsv01120  Microbial metabolism in diverse environments
bsv01130  Biosynthesis of antibiotics
bsv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bsv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSVBI22_A1807
   00620 Pyruvate metabolism
    BSVBI22_A1807
   00640 Propanoate metabolism
    BSVBI22_A1807
  Energy metabolism
   00680 Methane metabolism
    BSVBI22_A1807
Enzymes [BR:bsv01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BSVBI22_A1807
Lipid biosynthesis proteins [BR:bsv01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BSVBI22_A1807
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AEU06793
Position
I:1741106..1743061
Genome map
AA seq 651 aa AA seqDB search
MSEKLYPVLPEAKKNTLIDNETYLEWYEESVSDPDGFWAKHGRRIDWFKPFTKVKNTDFN
GDVTIKWYEDGVTNVSYNCIDRHLKSRGDKVAIIWEGDNPYIDKKITYRELYENVCRMAN
VLKKHGVKKGDRVTIYLPMIPEAAYAMLACARIGAVHSVVFAGFSPEALAGRIVDCESTF
VITADEGVRGGKPVALKENTDTAIDIAAKQYVMVNKVLVVRRTGGKVSWGRGRDLWYHQE
VASVEPHCEPEPMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYASMTHQYVFDYHDGEI
YWCTADVGWVTGHSYIVYGPLANGATTLMFEGVPNFPDQGRFWEVVDKHHVNIFYTAPTA
LRALMGAGDEFVTRSSRSTLRLLGSVGEPINPEAWEWYYNVVGDQKCPIVDTWWQTENGG
ILITPLPGATDLKPGSATRPFFGVKPVLVDNEGNVQEGVADGNLCISDSWPGQMRTVYGD
HKRFIETYFSTYKGMYFSGDGCRRDEDGYYWITGRVDDVLNISGHRLGTAEIESALVSHH
SVSEAAVVGYPHPIKGQGIYCYVTLMTGADAQDPDELRKELVQHVRKEIGPIATPDKIQF
APGLPKTRSGKIMRRILRKIAEDEFGALGDTSTLADPGVVDDLIENRQNKK
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaaaagctttaccccgtgctgccggaggcaaagaaaaacacgctcatcgacaac
gagacttatctcgaatggtatgaggagagcgtgagcgacccggatggcttctgggccaag
cacggccggcgtatcgactggttcaagcctttcaccaaggtcaagaacaccgatttcaac
ggcgatgtaacgatcaagtggtatgaggatggcgtcaccaacgtctcatataattgcatc
gaccgccatctgaagagccgcggcgacaaggtcgccatcatctgggaaggcgacaacccc
tatatcgacaagaagatcacctatcgcgagctttacgagaatgtctgccgcatggcgaat
gtgctcaagaagcatggggtgaagaagggcgaccgcgtcacgatctatctgccgatgatc
ccggaagccgcctatgccatgctcgcctgcgcgcgcatcggcgccgtgcattcggtcgtc
tttgccggtttctcgccggaggcgctcgctggccgcatcgttgactgcgaatccactttc
gtcatcaccgccgatgaaggtgtgcgcggcggcaagcctgttgcgctgaaggaaaacacc
gataccgccatcgacatcgccgccaagcaatatgtgatggtcaacaaggtgctggtcgtg
cgccgcaccggcggcaaggtaagctggggccgcggccgcgatctgtggtaccatcaggaa
gtcgcaagcgtcgaaccgcattgcgaaccggaaccgatgaatgcggaagacccgcttttc
attctctacacatccggttccaccggcaagccgaagggtgtgctgcataccaccggcggc
tacctcgtctatgcctcgatgacgcatcaatatgtcttcgattaccatgatggcgagatc
tactggtgcacggcggatgtgggttgggtaacgggccactcctatatcgtctacggaccg
ctggccaatggcgcgacaacgctgatgtttgaaggcgtgcccaacttccccgatcagggc
cgtttctgggaagtcgtcgacaagcaccatgtcaatatcttctacaccgcgccaaccgcg
ctgcgcgcgcttatgggcgcgggcgatgaattcgtaacccgctcatcgcgttcgacgctg
cgcctgctgggctcggtcggcgagccgatcaatccagaggcctgggagtggtattacaat
gtcgtgggcgaccagaaatgccccatcgtcgatacctggtggcagacggaaaatggcggc
atcctcatcaccccacttcccggcgcgaccgatttgaaacccggttcggcaacacgcccg
ttcttcggcgtcaagccggtgctggtggacaatgaaggcaatgtgcaggagggcgtagcc
gacggcaacctgtgcatctccgactcctggccgggccagatgcgcaccgtctatggcgac
cacaagcgtttcatcgaaacctacttctccacctataaggggatgtatttttcgggcgat
ggctgccgccgcgacgaggacggctattactggatcaccggccgcgtcgatgacgtgctg
aatatttccggccatcgcctcggcacggcggaaatcgaatcggcacttgtctcgcatcac
tcggtttcggaagccgccgtggtcggctatccgcacccgatcaagggacagggcatctat
tgctatgtcacgctgatgaccggcgcagacgcgcaggacccggacgagttgcgcaaggaa
ctggtccagcatgtgcgcaaggaaatcggccccatcgccacaccggacaagatccagttt
gcgcccggactgccgaaaacccgttccggcaagatcatgcgccgcatcctgcgcaagatc
gccgaagacgagttcggcgcattgggcgacacctcaacgctcgccgatccgggcgtggtg
gacgacctgatcgaaaatcgccagaacaagaaatga

DBGET integrated database retrieval system