KEGG   Brucella suis VBI22: BSVBI22_A1899Help
Entry
BSVBI22_A1899     CDS       T01706                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein, putative
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
bsv  Brucella suis VBI22
Pathway
bsv00020  Citrate cycle (TCA cycle)
bsv00190  Oxidative phosphorylation
bsv00650  Butanoate metabolism
bsv01100  Metabolic pathways
bsv01110  Biosynthesis of secondary metabolites
bsv01120  Microbial metabolism in diverse environments
bsv01130  Biosynthesis of antibiotics
bsv01200  Carbon metabolism
Module
bsv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bsv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bsv_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bsv00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BSVBI22_A1899
   00650 Butanoate metabolism
    BSVBI22_A1899
  Energy metabolism
   00190 Oxidative phosphorylation
    BSVBI22_A1899
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS Ribophorin_II
Motif
Other DBs
NCBI-ProteinID: AEU06883
Position
I:complement(1839489..1839884)
Genome map
AA seq 131 aa AA seqDB search
MNGMNNDMRTPLGKVRGLGSAKEGTSHFWYQRLSAVALVPLVLFFIGLVISLNGASYAEV
RAALSHPFTAVVMALFVLMGVYHMRLGMQVIIEDYVHGEGMKIVLVMLNTFFTVVVGLAC
VFAILKLSFGG
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcatgaataacgatatgcgtactccgctcgggaaggttcgcggtctgggttcg
gcaaaagaaggcaccagccatttctggtatcagcgcctgagcgccgttgccctggtgccg
ctggttctgtttttcatcggcctggtcatttcgctcaatggcgcaagctatgcagaagtc
cgggctgccctgtcacatcccttcaccgctgtggtgatggcgctgtttgtcctcatgggc
gtttatcacatgcgcctgggtatgcaggttattattgaagattatgtgcatggcgaaggc
atgaagatcgtgctggtgatgctgaacaccttctttacggtggtggttggtcttgcctgc
gttttcgcgatcctcaagctcagctttggaggttga

DBGET integrated database retrieval system