KEGG   Brucella suis VBI22: BSVBI22_B0005Help
Entry
BSVBI22_B0005     CDS       T01706                                 

Definition
ribokinase, putative
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bsv  Brucella suis VBI22
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bsv00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BSVBI22_B0005
Enzymes [BR:bsv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BSVBI22_B0005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:2092..3033
Genome map
AA seq 313 aa AA seqDB search
MSHGEAPLKIFVFGSVNVDVSARMAALPRPGQTVNASGYGIGLGGKGANQAVAVAKLGGA
IRFVGAVGHDAFGELALKQMREFGLDTGSVRVIDDVDTGMAIIQVEETGQNTIAVCAGAN
ARWSSADIDAYGADIAKARITLLQREVPHEANLAVAKAVRAAGGTVLLDPAPVGDASQMA
DLIALSDIISPNETEAAEITGIEPTDLASAEAAGRKLLERGPKIVILKLGSRGALLVTAD
EVKHFTPFKVKVVDTVAAGDSFNGGFAVAFSQARPLHDCVRYGSAAGAIAVTRVGAGAAA
PTAREVEELIGRA
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgagccatggagaagccccgttgaagattttcgttttcggcagtgtgaatgtggatgta
agcgcccgaatggctgccctgccgcggccggggcagacggtaaacgcatccggctatggc
atcgggctgggtggcaaaggagccaatcaggcggttgcggtggcaaaacttggcggggca
atccgatttgtcggcgcggtcggccatgatgcctttggcgaactggccttaaagcagatg
cgcgagtttgggctggataccggcagcgtgcgcgtgatcgatgacgtcgatacaggcatg
gcgatcatccaggtggaggaaaccgggcagaacacgattgcggtctgtgctggcgccaat
gcgcgctggtcgtcagccgatattgatgcttatggcgctgatattgccaaggcaaggatt
acgcttttgcagcgcgaagtgccgcatgaagccaatctggccgttgcgaaagccgtgcgg
gcagcgggtggaaccgtcctgctcgacccggccccggtgggggatgcaagccagatggcc
gatcttatcgccctgagcgacatcatttcgcccaacgagacggaagccgctgaaatcacc
ggcattgagccgaccgacctcgcttcggcggaagcggcggggcgcaagcttctggagcgc
ggcccgaagatcgtcatcctcaagcttggaagccgtggcgcgctgctggtaacggcggat
gaggtgaaacacttcacgccgttcaaggtaaaggtggtggatacggttgcagccggtgac
agtttcaacggcggctttgccgttgctttctcgcaggcgcggcccttgcatgattgcgtg
cggtatggttcggcggcgggcgcgattgcggttacgcgggttggcgcaggcgctgccgcg
ccaaccgcgcgtgaggttgaggaactcatcgggcgcgcttga

DBGET integrated database retrieval system