KEGG   Bacillus subtilis XF-1: C663_0741Help
Entry
C663_0741         CDS       T02459                                 

Gene name
lplD
Definition
putative glycosidase (EC:3.2.1.-)
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
bsx  Bacillus subtilis XF-1
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bsx00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bsx00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:bsx00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
800279..801619
Genome map
AA seq 446 aa AA seqDB search
MFHISTLDQIKIAYIGGGSQGWARSLMSDLSIDERMSGTVALYDLDFEAAQKNEVIGNHS
GNGRWRYEAVSTLKKALSAADIVIISILPGSLDDMEVDVHLPERCGIYQSVGDTVGPGGI
IRGLRAVPIFAEIARAIRDYAPESWVINYTNPMSVCTRVLYKVFPGIKAIGCCHEVFGTQ
KLLVEMVTERLGIEVPRREDIRVNVLGINHFTWITKASYRHIDLLPIFREFSAHYGESGY
ELEGESWRDSVFCSAHRVAFDLFETYGAIPAAGDRHLAEFLPGPYLKQPEVWRFHLTPIS
FRKQDRAEKRQETERLIVQQRGVAEKASGEEGVNIIAALLGLGELVTNVNMPNQGQVSNL
PIQAIVETNAFITRNRVQPIFSGALPKGVEMLAARHISNQEAVSEAGLTKDTGLAVQAFL
NDPLVRIDRSDAEQLFNDMLQCTMQR
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
gtgtttcatatcagtacattagatcagattaagattgcctatatcggcggggggtcccaa
ggctgggccagaagcctgatgagtgatttgtcgattgatgaacggatgtcaggcacggtg
gcgctctatgatcttgattttgaagccgctcagaaaaatgaagtgatcggcaatcacagc
gggaacggcagatggagatatgaggctgtttctactttgaaaaaggcgttatcagccgct
gatatcgtcattatttccattttgccgggatcactggatgatatggaagtcgatgtccac
ttgcctgagcgctgcggtatttatcagtctgtaggtgatactgtcgggcccggagggatc
atcaggggcttgcgtgctgtgccgatatttgcggaaattgcccgggcaataagagactac
gcacctgaatcatgggtcattaattatacaaacccgatgtctgtctgtacaagagtgctg
tataaagtgtttcccggaatcaaagcgattggctgctgccacgaggtatttgggacgcaa
aagctattggtggaaatggtcacggaaaggctggggatagaggtgccgcggcgtgaggat
atccgcgttaatgtgctcggcattaaccattttacatggatcacaaaagcctcttaccgc
catattgacctgctgcctatattccgtgaattcagcgcgcactatggggaatcaggatat
gagctggagggggaaagctggagggacagcgtcttttgttcggcacaccgtgttgcgttt
gatttatttgaaacgtatggcgccatccctgctgcaggagacaggcatctggcagagttt
cttcccggcccatacctcaaacagcctgaagtatggagatttcatctcacacctatatca
ttcagaaaacaagacagagctgagaaacgacaagaaacagaacggttgatcgtgcaacaa
cggggcgttgctgagaaagcttcgggagaagaaggcgtgaacatcatagcggctcttctc
ggattgggtgaactcgtcacaaatgtaaatatgccgaatcaaggccaggtctcaaacctt
cctatacaagccattgtcgaaacaaacgcattcatcacaaggaaccgtgtccagccgatt
ttttccggagcgcttccgaaaggtgtggaaatgctggcggctaggcatatatccaatcaa
gaggcagtgtcggaagcaggtctaacaaaggatactggcctcgcggttcaagctttcctc
aatgacccgcttgtcaggattgaccgcagtgatgcagagcagcttttcaatgacatgctc
caatgcaccatgcaacgttga

DBGET integrated database retrieval system