KEGG   Bacillus subtilis XF-1: C663_0751Help
Entry
C663_0751         CDS       T02459                                 

Gene name
cypD
Definition
putative cytochrome
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bsx  Bacillus subtilis XF-1
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsx00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    C663_0751 (cypD)
  Amino acid metabolism
   00380 Tryptophan metabolism
    C663_0751 (cypD)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    C663_0751 (cypD)
Enzymes [BR:bsx01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     C663_0751 (cypD)
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     C663_0751 (cypD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
807604..810789
Genome map
AA seq 1061 aa AA seqDB search
MKETSPIPQPKTFGPLGNLPLIDKDKPTLSLIKLAEEQGPIFQIHTPAGTTIVVSGHELV
KEVCDEERFDKSIEGALEKVRAFSGDGLFTSWTHEPNWRKAHNILMPTFSQRAMKDYHEK
MVDIAVQLIQKWARLNPNEAVDVPGDMTRLTLDTIGLCGFNYRFNSYYRETPHPFINSMV
RALDEAMHQMQRLDVQDKLMVRTKRQFRHDIQTMFSLVDSIIAERRSNGDQDEKDLLARM
LNVEDPETGEKLDDENIRFQIITFLIAGHETTSGLLSFATYFLLKHPDKLKKAYEEVDRV
LTDAAPTYKQVLELTYIRMILNESLRLWPTAPAFSLYPKEDTVIGGKFPITTKDRISVLI
PQLHRDRDAWGKDAEEFRPERFEHQDQVPHHAYKPFGNGQRACIGMQFALHEATLVLGMI
LKYFTLIDHENYELDIKQTLTLKPGDFHIRVQSRNQEAIHADVQAAEKAVSDEQKEKTEA
KGASVIGLNNRPLLLLYGSDTGTAEGVARELADTASLHGVRTETAPLNDRIGKLPKEGAV
VIVTSSYNGKPPSNAGQFVQWLQEIKPGELEGVHYAVFGCGDHNWASTYQYVPRFIDEQL
AEKGATRFSARGEGDVSGDFEGQLDEWKKSMWADAIKAFGLELNENADKERSTLSLQFVR
GLGESPLARSYEASHASIAENRELQSADSDRSTRHIEIALPPDVEYQEGDHLGVLPKNSQ
TNVSRILHRFGLKGTDQVTLSASGRSAGHLPLGRPVSLHDLLSYSVEVQEAATRAQIREL
AAFTVCPPHRRELEELSAEGVYQEQILKKRISMLDLLEKYEACDMPFERFLELLRPLKPR
YYSISSSPRVNPRQASITVGVVRGPAWSGRGEYRGVASNDLAERKAGDDVVMFIRTPESR
FQLPEDPETPIIMVGPGTGVAPFRGFLQAREVLKREGKTLGEAHLYFGCRNDRDFIYRDE
LEQFEKDGIVTVHTAFSRKEGMPKTYVQHLMADHAETLISILDRGGRLYVCGDGSKMAPD
VEAALQKAYQSVHGTGEQEVQNWLRHLQDTGMYAKDVWAGI
NT seq 3186 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaaacaagcccgattcctcagccgaagacgtttgggccgctaggcaatttgcct
ttaatcgataaagacaagccgacgctttcgctgatcaaactggcggaagaacagggcccg
atttttcaaatccatacacccgcgggcacgaccattgtagtgtccggccacgaattggtg
aaagaggtttgtgatgaagaacggtttgataaaagcattgaaggcgccttggaaaaggtt
cgcgcattttccggtgacggattgtttacgagctggacgcatgagcctaactggagaaaa
gcgcacaacattctgatgccgacgttcagccagcgggccatgaaggactatcatgagaaa
atggtcgatatcgctgttcagctcattcaaaaatgggccaggctcaatccgaatgaagca
gtcgatgtcccgggagatatgacccggctgacgctcgacaccattgggctatgcgggttt
aactaccgctttaacagttactacagagaaacgccccacccgtttatcaacagcatggtg
cgggcgcttgatgaagcgatgcatcaaatgcagcggcttgatgttcaagataagcttatg
gtcagaacaaagcggcaattccgccatgatattcaaacgatgttttcgttagtcgacagc
attattgcagagcgccgatcgaatggagaccaggatgaaaaagatttgctcgcccgcatg
ctgaatgtggaagatccggaaacgggtgaaaagctcgacgacgaaaatatccgctttcag
atcattacgtttttgattgccggccatgaaacaacgagcggcctgctctcctttgcgacc
tactttttattgaagcatcctgacaaactgaaaaaggcgtatgaagaggtcgatcgggtg
ctgacggatgcagcgccgacctataaacaagtgctggagcttacatacatacggatgatt
ttaaatgaatcactgcgcttatggccgacagctccggctttcagcctttatccaaaagaa
gacacagtcattggcggaaaattcccgatcacgacgaaagacagaatttctgtgctgatt
ccgcagcttcatcgtgatcgagacgcttggggaaaggacgcagaagaattccggccggaa
cggttcgagcatcaggaccaagtgcctcaccatgcgtacaaaccattcggaaatggccaa
cgggcctgtatcggcatgcagtttgcccttcatgaagccacacttgtgctgggcatgatt
ctaaaatatttcacactgattgatcatgagaattatgagcttgatatcaaacaaacctta
acacttaagccgggcgattttcacatcagggttcaaagccgtaatcaggaagccattcat
gcggacgtccaggcagctgaaaaagccgtgtctgatgagcaaaaggagaaaacggaagca
aagggcgcatcggtcatcggtcttaacaaccgcccgcttctcttactgtacggctctgat
accggcactgcagaaggcgtcgcccgggagcttgctgatactgccagtcttcacggcgta
aggacagagacagcccctctgaacgaccgaattggaaagctgccgaaagagggagcggtt
gtcattgtgacctcgtcttataatggaaaaccgccaagcaatgccggacagttcgtgcag
tggcttcaagaaatcaaaccgggtgagcttgagggcgttcattacgcggtatttggctgc
ggcgaccacaactgggcgagcacgtatcaatacgtgccgagattcattgatgagcagctt
gcggaaaaaggcgcgactcggttttctgcgcgcggagaaggtgatgtcagcggtgatttt
gaagggcagcttgacgagtggaaaaaaagcatgtgggcggacgccattaaggcattcgga
cttgagcttaatgaaaacgctgataaggagcgaagcacgctgagccttcagtttgtcaga
gggctgggcgagtctccgctggctagatcatacgaagcctctcacgcatccattgccgaa
aatcgtgaactccagtctgcagacagcgatcgaagcactcgccatatcgaaattgcattg
ccgccggatgttgaatatcaagagggcgaccatcttggcgtattgccaaaaaacagccaa
accaatgtcagccggattctccacagattcggtctgaagggaaccgaccaagtgacattg
tcggcaagcggccgcagtgcggggcatctgccattgggccgtcctgtcagcctgcatgat
cttctcagctacagcgtcgaggtgcaggaagcagccacaagagcgcaaatacgtgaactg
gcggcatttacagtgtgtccgccgcataggcgtgaattagaagaactgtcagcagagggt
gtttatcaggagcaaatattgaaaaaacgaatttccatgctggatctgcttgaaaagtat
gaagcgtgtgacatgccgtttgaacgatttttagagcttttacgtccgttaaaaccgaga
tattattcaatttcaagctctccaagagtgaatccgcggcaagcatcgatcacagtcggt
gtcgtgcgcggccctgcgtggagcggccgtggcgaatacaggggcgtggcttcaaatgat
ttagctgagcgtaaagccggtgatgatgtcgtgatgtttatccgcacaccggaatcccgg
tttcagcttccagaagaccctgaaactccaatcattatggtcggaccaggcacaggagta
gcgccattccgcggtttccttcaagcccgtgaagttttaaagcgggaggggaaaacgctc
ggtgaagctcatctctattttggatgcaggaacgatcgtgattttatataccgcgatgag
cttgagcagtttgaaaaagacggaatcgtcactgtccacacagccttttcccgcaaagaa
ggcatgccgaaaacgtatgtccagcatctaatggctgaccatgcagaaacattaatatcg
atccttgaccgcggaggcaggctttatgtatgcggtgatggcagcaaaatggccccggat
gtggaggcggcactgcaaaaggcgtatcagtctgttcatggcaccggggagcaagaagtg
caaaactggctgagacatctgcaggataccggtatgtacgctaaggatgtctgggcaggg
atatag

DBGET integrated database retrieval system