KEGG   Bacillus subtilis XF-1: C663_1038Help
Entry
C663_1038         CDS       T02459                                 

Gene name
hemY
Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
bsx  Bacillus subtilis XF-1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    C663_1038 (hemY)
Enzymes [BR:bsx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     C663_1038 (hemY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1092879..1094327
Genome map
AA seq 482 aa AA seqDB search
MNMSDGKKHVVIIGGGITGLAAAFYMEKEIKEKNLPLELTLVEASPRVGGKIQTVKKDGY
IIERGPDSFLERKKSAPQLVKDLGLEHLLVNNATGQSYVLVNRTLHPMPKGAVMGIPTKI
APFVSTGLFSLSGKARAAMDFILPASKTKDDQSLGEFFRRRVGDEVVENLIEPLLSGIYA
GDIDKLSLMSTFPQFYQTEQKHRSLILGMKKTRPQGSGQQLTAKKQGQFQTLSTGLQTLV
EEIEKQLKLAKVYKGTKVTKLSHSGSGYSLELDNGVTLDADSVIVTAPHKAAAGMLSELP
AISHLKNMHSTSVANVALGFPEGSVQMEHEGTGFVISRNSDFAITACTWTNKKWPHAAPE
GKTLLRAYVGKAGDESIVDLSDNDIINIVLEDLKKVMNINGEPEMTCVTRWHESMPQYHV
GHKQRIKELREALASAYPGVYMTGASFEGVGIPDCIDQGKAAVSDALPYLFSKTLRYIAE
VF
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgagtgacggcaaaaaacatgtagtcatcatcggcggcggcattaccggttta
gccgccgccttctatatggaaaaagaaatcaaagaaaagaatctgccgcttgagctgaca
cttgttgaggcaagtccgagagtcggcgggaaaatccagactgtcaagaaagacggctat
atcatcgaaagagggccagactcatttctggaacgaaagaaaagcgccccgcagcttgtt
aaagacttaggtcttgagcatttgcttgtcaacaatgcgactggacaatcctatgtgctt
gtaaaccgcaccctgcatccaatgccgaagggcgctgtaatggggataccgacaaaaatt
gcgccgtttgtttctacgggtctgttttccttgtccgggaaggcgagagctgctatggat
ttcatcctgcctgcaagcaaaacaaaggatgatcagtcattgggagaattcttccgcaga
cgtgtcggagatgaagtggtcgagaacttaatcgagccgcttctatcaggaatctacgca
ggcgacattgacaagcttagcctgatgtcgacattcccgcaattttaccagacggaacaa
aagcatagaagcctgattctcggcatgaaaaaaacaagacctcaaggctcaggccagcag
ctgacggcaaaaaaacaagggcagttccagactctgtcaaccggtttgcagacccttgta
gaagagatcgaaaagcagttaaagctggcgaaggtgtataaaggcacaaaagtgaccaaa
ctcagccatagcggctctggctattcgctcgaacttgataacggcgtcacacttgatgct
gattcagtaattgtgactgctccgcataaagcggctgcgggaatgctttctgagcttcct
gccatttctcatttgaaaaatatgcactccacatccgtggcaaacgtcgctttaggtttc
cctgaaggctccgtccaaatggagcatgagggcacgggttttgtcatttcaagaaacagt
gactttgcgatcacagcctgtacgtggacgaataaaaaatggccgcacgcagcgccggaa
ggcaaaacgctgcttcgggcatatgtcggaaaagccggagacgaatccattgtcgatcta
tcagataatgacattatcaacattgtgttagaagacttaaagaaagtcatgaacataaac
ggcgagccggaaatgacatgtgtcacccgatggcatgaaagcatgccgcagtaccatgtc
ggccataagcagcgtatcaaggagctgcgtgaagcacttgcatctgcgtatccgggtgtt
tatatgacaggcgcttctttcgaaggtgtcggcattcccgactgcattgatcaaggaaaa
gctgccgtgtctgacgcgcttccctatttattcagcaaaaccctccgctatatcgcggag
gttttttga

DBGET integrated database retrieval system