KEGG   Bacillus subtilis XF-1: C663_1255Help
Entry
C663_1255         CDS       T02459                                 

Gene name
yjjA
Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bsx  Bacillus subtilis XF-1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    C663_1255 (yjjA)
Enzymes [BR:bsx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     C663_1255 (yjjA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1297241..1298080
Genome map
AA seq 279 aa AA seqDB search
MQRGEETGMGKGLLGKRVAIGGSRKTEEISTIIEKQGGIPVIRPLQGTVYLSEKQVEPDL
RTFVEGKKADWVIFTTGIGLETLVDMAEKIGLKDEFLQAIRQAKAACRGYKTLSALKKLG
ITPEASDEDGTTRGLIRSLEPHDFSGKTVMVQLHGEKAPALMAFLEEKGASVLPILPYQH
IPPEEETVERLCRELMNGEIDAVCFTTAIQVRSLFDFAKGRGYINEVKKVFEERAIAAAV
GKVTAEALREEGITRLLAPEIERMGAMIVELAKYYEEKE
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagaggagaggaaacgggtatgggaaaagggttacttggaaaacgcgtggcaatc
ggtggctcacgaaaaacggaagaaatcagtacaatcattgaaaaacagggcggaatacct
gtcatccggcctctccaaggtacagtttacttatcagagaagcaggtggagccggatttg
cggacgtttgtggagggaaaaaaagctgactgggttattttcacgacaggcatcgggttg
gagactcttgtcgatatggcagagaaaattggactgaaagatgagtttctgcaggccatt
cgccaagcgaaagcggcatgcaggggatacaaaacgctgtctgcgctgaaaaagcttggg
atcacaccggaagcttcggatgaagacgggacaacaagaggcttaatccgttctttggag
cctcacgacttttcaggaaaaacagtcatggtacagcttcatggcgaaaaagcgccggct
ctcatggcatttcttgaagaaaaaggcgcgtctgtcctgccgattctgccttatcagcac
atcccgccggaggaggaaacggtggagcggttatgccgagagctgatgaacggtgagatc
gatgccgtttgttttacaacggccattcaggttcgttccctgtttgattttgctaagggg
cgaggttatatcaatgaagtgaagaaggtattcgaagaacgtgccatcgcagctgctgtc
ggaaaagtgactgctgaagcactgcgggaagagggcattacgagactgcttgcgccagag
attgagcggatgggtgcgatgattgttgagctggccaagtattatgaagaaaaggaataa

DBGET integrated database retrieval system