KEGG   Bacillus subtilis XF-1: C663_1350Help
Entry
C663_1350         CDS       T02459                                 

Gene name
proB
Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
bsx  Bacillus subtilis XF-1
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bsx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    C663_1350 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    C663_1350 (proB)
Enzymes [BR:bsx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     C663_1350 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1381649..1382746
Genome map
AA seq 365 aa AA seqDB search
MKKQRIVVKIGSSSLTNSKGSIDEAKIREHVQAISVLKKAGHEMILITSGAVAAGFSSLG
YPSRPVTIKGKQAAAAVGQTLLMQQYMNQFKQYSLTPGQILLTRNDFSKRERYRNAYATI
MELLERGVIPIINENDSTSVEELTFGDNDMLSALVSGLIHADQLMILTDINGLYDANPNE
NPEAKRFDYLPEITPELLGYAGSAGSKVGTGGMKSKLLAAQTALSLGVKVFIGTGSGEQK
LADILDGRGDGTYIGDKELSSVNNTRQWIQFHSPISGEIIIDAGAEEAMIHNGSSLLPAG
VVGVNGSFPKGAVVEVRGPGGVIGKGQTHYSSEEIMEAKGKRSDELDFEKTFEVIHRNDW
VNVKD
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacaaagaatagtagtgaaaataggaagcagttcgctcacgaatagcaaagga
agcattgatgaggcaaaaatcagagagcatgttcaggcgatttccgtgttaaaaaaagcg
gggcatgaaatgattctgattacctcgggtgccgttgcggcggggttttccagcctcggt
tatccgtcccgccccgttaccatcaaaggaaaacaggcggcggccgcggtcggacaaaca
ctgttaatgcagcaatatatgaatcaatttaaacaatactcactgactccgggacaaatc
cttttaacgagaaatgatttttcgaaaagagaacggtaccgaaacgcgtatgctacgata
atggaattattggaacgcggcgtcattccgattatcaacgagaacgattctacatctgtt
gaagaattgacattcggagataatgatatgctttctgcgttagtcagcggattgattcac
gcggaccagctcatgattctcaccgacatcaacggactgtatgatgcaaatccgaatgaa
aatcctgaggcgaaacgatttgattatttgccggagatcacgcctgaattgcttggatat
gcaggttcagccggatcaaaggtcggcaccggcggaatgaaatcaaagctgttagccgca
caaaccgcgctgtctctgggagtgaaagtattcattggaacaggcagcggagagcaaaaa
cttgcggatattttggacggcaggggagacggcacttatatcggagacaaagaactatct
tcggttaacaacacaaggcagtggattcagttccactcgccgatatcgggagaaattatc
attgatgcgggtgccgaagaggcgatgatccataatggaagcagtcttttgcccgctggc
gttgtgggtgtgaacgggagctttccgaaaggggcggttgtggaagtcaggggaccgggc
ggcgtgatcggcaaaggccaaactcattactcctctgaggagattatggaggccaaaggc
aaacgcagtgacgaacttgattttgagaaaacgtttgaggttattcataggaatgactgg
gtcaatgtaaaagactag

DBGET integrated database retrieval system