KEGG   Bacillus subtilis XF-1: C663_1379Help
Entry
C663_1379         CDS       T02459                                 

Gene name
ykoU
Definition
ATP-dependent DNA ligase
Orthology
K01971  
DNA ligase (ATP) [EC:6.5.1.1]
Organism
bsx  Bacillus subtilis XF-1
Pathway
Base excision repair
Nucleotide excision repair
Mismatch repair
Non-homologous end-joining
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:bsx03410]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:bsx03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:bsx03430]
Genetic Information Processing; Replication and repair; Non-homologous end-joining [PATH:bsx03450]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1408388..1410223)
Genome map
AA seq 611 aa AA seqDB search
MAFTMQPVLTSSPPIGAEWRYEVKYDGYRCILRIHSSGVTLTSRNGVELSSTFPEITQFA
KTAFQHMEKELPLTLDGEIVCLVNPCRADFEHLQVRGRLKRPDKIQESANARPCCFLAFD
LLERSGEDVTLLSYLDRKKSLRELISAAKLPASPDPYAKETIQSIPCYDHFDQLWEMVIK
YDGEGIVAKKTNSKWLEKKRSSDWLKYKNFKQAYVCITGFNPNNGFLTVSVLKNGIMTPI
ASVSHGMRDEEKSAIREIMEQHGHQTPSGGFTLEPSICAAVQYLTILQGTLREVSFVGFE
FQMDWTECTYAQVIRHSKPVHPKLQFTSLDKIIFEKNKKTKEDFIQYMIEVSDSLLPFLK
NRAVTVIRYPHGSRSESFFQKNKPDYAPDFVQSFYDGSHEHIVCEDMSTLLWLCNQLALE
FHVPFQTIKSRRPAEIVIDLDPPSRDDFLMAVQAANELKRLLDSFGITSYPKLSGNKGIQ
LYIPLSPEAFTYEETRQFTQLIAEYCTNAFPELFTTERLIKNRHGKLYLDYLQHAEGKTI
ICPYSTRGNELGTVAAPLYWHEVQSSLTPALFTIDTVINRIKKQGCPFFDFYRNPQDEPL
SAILHQLKKKS
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttaccatgcagccggtcctaacttcgtcaccgccaatcggagcagaatggcgt
tacgaagtaaaatatgatgggtaccgctgtattctccgcatccattcttcaggtgtgacc
ttaaccagcagaaatggtgtggagctcagcagcaccttccctgaaatcacacaattcgcc
aaaactgcctttcagcacatggaaaaagagcttccgctgacacttgatggtgaaatcgta
tgtttggtgaatccttgtcgtgcagattttgaacaccttcaagtgcgggggcgtttgaaa
aggccagacaagattcaggaatcggcaaacgcgcggccgtgctgctttctcgcctttgat
ttgttagagcgaagcggagaagatgtaacgcttctttcgtatttggaccgcaaaaaatcg
ctgcgtgaactcatatccgcagcaaagcttcctgcatctccagatccttacgcaaaagaa
accattcaatccattccctgttatgatcattttgatcaactctgggagatggtaataaaa
tatgacggagaaggaattgtagcgaagaaaacaaacagcaaatggcttgaaaagaagcgg
tcgtccgattggctcaaatataaaaactttaaacaagcttatgtttgcataacagggttc
aaccctaacaacgggtttctgacggtatcagtattaaaaaacggaataatgacaccgatt
gcctctgtctcgcacggaatgcgcgatgaggaaaaaagcgctatacgcgagattatggaa
cagcacggacatcaaacaccctcaggcggatttacgcttgaaccttcgatttgtgcagct
gttcaatacttaacaattctccaaggcacattaagagaggtatcgtttgtcggtttcgaa
ttccaaatggactggaccgaatgcacgtatgcgcaagtcatacgacactccaaaccggtt
cacccaaagctgcagttcacaagcctggataaaatcatatttgaaaagaataaaaaaaca
aaagaagattttattcagtatatgattgaagtcagtgactccctgctcccatttctgaaa
aaccgggctgtcaccgtcatccgctatccgcatggatctaggagcgaatcatttttccaa
aaaaacaagccggactatgcgccggattttgttcaatctttctatgatggaagccatgaa
catattgtctgtgaggatatgtctacattgctatggctttgcaaccagcttgctttggag
tttcacgttccttttcaaaccattaaaagcaggcgtccggctgagattgtcattgattta
gacccgccttcgcgagatgactttcttatggccgtgcaggccgcaaatgaactgaagcgg
ctgttggattcctttggcatcacatcgtacccgaagctgtccggcaacaaaggcatccag
ctttatattcccttgtctcccgaggcatttacgtatgaagaaacacgccaatttacgcag
ttgatcgcagagtactgcaccaatgcatttcccgagctatttaccactgaacgcttgatt
aaaaacagacacggcaaattgtatcttgattatttgcagcatgcagaaggaaaaacgatt
atctgtccctattcgacgagaggaaatgagcttgggactgttgcagccccgctctactgg
catgaggtgcaatcatctttaacacccgctctgtttacaattgatacggtcatcaatcga
attaagaagcagggctgcccattttttgatttttaccgcaacccgcaagacgaaccgctt
agcgctattttacatcagttgaagaaaaagagctga

DBGET integrated database retrieval system