KEGG   Bacillus subtilis XF-1: C663_1379Help
Entry
C663_1379         CDS       T02459                                 

Gene name
ykoU
Definition
(RefSeq) ATP-dependent DNA ligase
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
bsx  Bacillus subtilis XF-1
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:bsx00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    C663_1379 (ykoU)
Enzymes [BR:bsx01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     C663_1379 (ykoU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1408388..1410223)
Genome map
AA seq 611 aa AA seqDB search
MAFTMQPVLTSSPPIGAEWRYEVKYDGYRCILRIHSSGVTLTSRNGVELSSTFPEITQFA
KTAFQHMEKELPLTLDGEIVCLVNPCRADFEHLQVRGRLKRPDKIQESANARPCCFLAFD
LLERSGEDVTLLSYLDRKKSLRELISAAKLPASPDPYAKETIQSIPCYDHFDQLWEMVIK
YDGEGIVAKKTNSKWLEKKRSSDWLKYKNFKQAYVCITGFNPNNGFLTVSVLKNGIMTPI
ASVSHGMRDEEKSAIREIMEQHGHQTPSGGFTLEPSICAAVQYLTILQGTLREVSFVGFE
FQMDWTECTYAQVIRHSKPVHPKLQFTSLDKIIFEKNKKTKEDFIQYMIEVSDSLLPFLK
NRAVTVIRYPHGSRSESFFQKNKPDYAPDFVQSFYDGSHEHIVCEDMSTLLWLCNQLALE
FHVPFQTIKSRRPAEIVIDLDPPSRDDFLMAVQAANELKRLLDSFGITSYPKLSGNKGIQ
LYIPLSPEAFTYEETRQFTQLIAEYCTNAFPELFTTERLIKNRHGKLYLDYLQHAEGKTI
ICPYSTRGNELGTVAAPLYWHEVQSSLTPALFTIDTVINRIKKQGCPFFDFYRNPQDEPL
SAILHQLKKKS
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttaccatgcagccggtcctaacttcgtcaccgccaatcggagcagaatggcgt
tacgaagtaaaatatgatgggtaccgctgtattctccgcatccattcttcaggtgtgacc
ttaaccagcagaaatggtgtggagctcagcagcaccttccctgaaatcacacaattcgcc
aaaactgcctttcagcacatggaaaaagagcttccgctgacacttgatggtgaaatcgta
tgtttggtgaatccttgtcgtgcagattttgaacaccttcaagtgcgggggcgtttgaaa
aggccagacaagattcaggaatcggcaaacgcgcggccgtgctgctttctcgcctttgat
ttgttagagcgaagcggagaagatgtaacgcttctttcgtatttggaccgcaaaaaatcg
ctgcgtgaactcatatccgcagcaaagcttcctgcatctccagatccttacgcaaaagaa
accattcaatccattccctgttatgatcattttgatcaactctgggagatggtaataaaa
tatgacggagaaggaattgtagcgaagaaaacaaacagcaaatggcttgaaaagaagcgg
tcgtccgattggctcaaatataaaaactttaaacaagcttatgtttgcataacagggttc
aaccctaacaacgggtttctgacggtatcagtattaaaaaacggaataatgacaccgatt
gcctctgtctcgcacggaatgcgcgatgaggaaaaaagcgctatacgcgagattatggaa
cagcacggacatcaaacaccctcaggcggatttacgcttgaaccttcgatttgtgcagct
gttcaatacttaacaattctccaaggcacattaagagaggtatcgtttgtcggtttcgaa
ttccaaatggactggaccgaatgcacgtatgcgcaagtcatacgacactccaaaccggtt
cacccaaagctgcagttcacaagcctggataaaatcatatttgaaaagaataaaaaaaca
aaagaagattttattcagtatatgattgaagtcagtgactccctgctcccatttctgaaa
aaccgggctgtcaccgtcatccgctatccgcatggatctaggagcgaatcatttttccaa
aaaaacaagccggactatgcgccggattttgttcaatctttctatgatggaagccatgaa
catattgtctgtgaggatatgtctacattgctatggctttgcaaccagcttgctttggag
tttcacgttccttttcaaaccattaaaagcaggcgtccggctgagattgtcattgattta
gacccgccttcgcgagatgactttcttatggccgtgcaggccgcaaatgaactgaagcgg
ctgttggattcctttggcatcacatcgtacccgaagctgtccggcaacaaaggcatccag
ctttatattcccttgtctcccgaggcatttacgtatgaagaaacacgccaatttacgcag
ttgatcgcagagtactgcaccaatgcatttcccgagctatttaccactgaacgcttgatt
aaaaacagacacggcaaattgtatcttgattatttgcagcatgcagaaggaaaaacgatt
atctgtccctattcgacgagaggaaatgagcttgggactgttgcagccccgctctactgg
catgaggtgcaatcatctttaacacccgctctgtttacaattgatacggtcatcaatcga
attaagaagcagggctgcccattttttgatttttaccgcaacccgcaagacgaaccgctt
agcgctattttacatcagttgaagaaaaagagctga

DBGET integrated database retrieval system