KEGG   Bacillus subtilis XF-1: C663_1815Help
Entry
C663_1815         CDS       T02459                                 

Gene name
xylA
Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
bsx  Bacillus subtilis XF-1
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsx00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    C663_1815 (xylA)
   00051 Fructose and mannose metabolism
    C663_1815 (xylA)
Enzymes [BR:bsx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     C663_1815 (xylA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1897797..1899134
Genome map
AA seq 445 aa AA seqDB search
MAQSHSSSINYFGSANKVVYEGKDSTNPLAFKYYNPQEVIGGKTMKEHLRFSIAYWHTFT
ADGTDVFGAATMQRPWDHYKGMDLAKMRVEAAFEMFEKLDAPFFAFHDRDIAPEGSTLKE
TNQNLDMIVGMIKDYMRNSGVKLLWNTANMFTNPRFVHGAATSCNADVFAYAAAQVKKGL
ETAKELGAENYVFWGGREGYETLLNTDLKFELDNLARFMHMAVDYAKEIGYTGQFLIEPK
PKEPTTHQYDTDAATTIAFLKQYGLDNHFKLNLEANHATLAGHTFEHELRMARVHGLLGS
VDANQGHPLLGWDTDEFPTDLYSTTLAMYEILQNGGLGSGGLNFDAKVRRSSFEPDDLIY
AHIAGMDAFARGLKVAHKLIEDRVFEDVIQHRYRSFTEGIGLEIIEGRANFHTLEQYALN
HKSIKNESGRQEKLKAILNQYILEV
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggctcaatctcattccagttcaatcaactattttggaagcgcaaacaaagtggtttac
gaagggaaagattcgactaatcctttagcatttaaatattataatcctcaagaagtaatc
ggcggaaaaacgatgaaagagcatttgcgattttctattgcctattggcatacatttact
gctgatggtacagacgtttttggagcagctacgatgcaaagaccatgggatcactataaa
ggcatggatctagcgaagatgagagtagaagcagcatttgagatgtttgaaaaactagat
gcaccattctttgcttttcatgaccgggatattgcaccagaaggcagtacgctaaaagag
acaaaccaaaatttagatatgatcgtgggcatgattaaagattacatgagaaatagcggc
gttaagctattatggaataccgcaaacatgtttacgaatccccgtttcgtccatggtgcc
gcgacttcttgcaatgcagatgtgtttgcgtatgctgcagcacaagtgaaaaaagggtta
gaaacagcaaaagagcttggcgctgagaactatgtattttggggcggccgtgaaggatat
gaaacattgttaaataccgatttgaaatttgagcttgataatttggctagatttatgcat
atggcagtggattatgcgaaggaaatcgggtacacagggcagtttttgattgagccaaaa
ccaaaagagccgaccacccatcaatacgatacagatgcagcaacaactattgcctttttg
aagcaatatggcttagacaatcattttaaattaaatcttgaagccaatcatgccacatta
gctgggcatacattcgaacatgaattgcgcatggcaagagtacatggtctgcttggctct
gttgacgcaaaccagggtcatcctcttttaggctgggacacggatgaatttccgacggat
ttatattctacgacattagcaatgtacgaaatcctgcaaaatggcggcctaggaagcggc
ggattaaactttgacgcgaaggtcagaagatcttcttttgagcctgatgatctaatatat
gcccatattgcagggatggatgcatttgcaagaggattgaaagttgcccacaaattaatc
gaagatcgtgtgtttgaagatgtgattcaacatcgttaccgcagctttactgaagggatt
ggtcttgaaattatagaaggaagagctaatttccacacacttgagcaatatgcgctaaat
cataaatcaattaaaaacgaatctggaagacaggagaaattaaaagcgatattgaaccaa
tacattttagaagtataa

DBGET integrated database retrieval system