KEGG   Bacillus subtilis XF-1: C663_1868Help
Entry
C663_1868         CDS       T02459                                 

Gene name
eglS
Definition
cellulase C (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bsx  Bacillus subtilis XF-1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsx00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    C663_1868 (eglS)
Enzymes [BR:bsx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     C663_1868 (eglS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1946344..1947843
Genome map
AA seq 499 aa AA seqDB search
MKRSISIFITCLLITLLTMGGMMASPASAAGTKTPVAKNGQLSIKGTQLVNRDGKAVQLK
GISSHGLQWYGEYVNKDSLKWLRDDWGITVFRAAMYTADGGYIDNPSVKNKVKEAVEAAK
ELGIYVIIDWHILNDGNPNQNKEKAKEFFKEMSSLYGNTPNVIYEIANEPNGDVNWKRDI
KPYAEEVISVIRKNDPDNIIIVGTGTWSQDVNDAADDQLKDANVMYALHFYAGTHGQFLR
DKANYALSKGAPIFVTEWGTSDASGNGGVFLDQSREWLKYLDSKTISWVNWNLSDKQESS
SALKPGASKTGGWRLSDLSASGTFVRENILGTKDSTRDIPETPAKDKPTQENGISVQYRA
GDGSMNSNQIRPQLQIKNNGNTTVDLKDVNARYWYKAKNKGQNVDCDYAQIGCGNVTYKF
VTLHKPKQGADTYLELGFKNGTLAPGASTGNIQLRLHNDDWSNYAQSGDYSFFKSNTFKT
TKKITLYDQGKLIWGTEPN
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggtcaatctctatttttattacgtgtttattgattacgttattgacaatgggc
ggcatgatggcttcgccggcatcagcagcagggacaaaaacgccagtagccaagaatggc
cagcttagcataaaaggtacacagctcgttaaccgagacggtaaagcggtacagctgaag
gggatcagttcacacggattgcaatggtatggagaatatgtcaataaagacagcttaaaa
tggctgagggacgattggggtatcaccgttttccgtgcagcgatgtatacggcagatggc
ggttatattgacaacccgtccgtgaaaaataaagtaaaagaagcggttgaagcggcaaaa
gagcttgggatatatgtcatcattgactggcatattttaaatgacggtaatccaaaccaa
aataaagagaaggcaaaagaattcttcaaggaaatgtcaagtctttacggaaacacgcca
aacgtcatttatgaaattgcaaacgaaccaaacggtgatgtgaactggaagcgtgatatt
aaaccgtatgcggaagaagtgatttccgttatccgcaaaaatgatccagacaacatcatc
attgtcggaaccggtacatggagccaggatgtgaatgatgctgccgatgaccagctaaaa
gatgcaaacgttatgtacgcacttcatttttatgccggcacacacggccaatttttacgg
gataaagcaaactatgcactcagcaaaggagcacctatttttgtgacagaatggggaaca
agcgacgcgtctggaaatggcggtgtattccttgatcaatcgagggaatggctgaaatat
ctcgacagcaagaccattagctgggtgaactggaatctttctgataagcaggaatcatcc
tcagctttaaagccgggggcatctaaaacaggcggctggcggttgtcagatttatctgct
tcaggaacattcgttagagaaaacattctcggcaccaaagattctacgagggacattcct
gaaacgccagcaaaagataaacccacacaggaaaatggtatttctgtacaatacagagct
ggggatgggagtatgaacagcaaccaaatccgtccgcagcttcaaataaaaaataacggc
aataccacggttgatttaaaagatgtcaatgcccgttactggtataaagcgaaaaacaaa
ggccaaaacgttgactgtgactacgcgcagattggatgcggcaatgtgacatacaagttt
gtgacgttgcataaaccaaagcaaggtgcagatacctatctggaacttggatttaaaaac
ggaacgttggcaccgggagcaagcacagggaatattcagcttcgtcttcacaatgatgac
tggagcaattatgcacaaagcggcgattattcctttttcaaatcaaatacgtttaaaaca
acgaaaaaaatcacattatatgatcaaggaaaactgatttggggaacggaaccaaattag

  All links  
No link information was found.   
DBGET integrated database retrieval system